Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   107832
Name   oriT_pEF45-4 in_silico
Organism   Escherichia fergusonii strain EF20JDJ4045
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP086608 (13731..13783 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pEF45-4
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   5502 GenBank   WP_229321795
Name   t4cp2_LNN29_RS24820_pEF45-4 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73492.13 Da        Isoelectric Point: 9.3476

>WP_229321795.1 type IV secretory system conjugative DNA transfer family protein [Escherichia fergusonii]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVLLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGEKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 33091..55921

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LNN29_RS24760 (LNN29_24710) 28133..29257 - 1125 WP_000486716 site-specific integrase -
LNN29_RS24765 (LNN29_24715) 30221..30418 + 198 WP_001356717 hypothetical protein -
LNN29_RS24770 (LNN29_24720) 31240..32439 - 1200 Protein_38 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
LNN29_RS24775 (LNN29_24725) 32452..33087 - 636 WP_000934977 A24 family peptidase -
LNN29_RS24780 (LNN29_24730) 33091..33573 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
LNN29_RS24785 (LNN29_24735) 33639..34202 - 564 WP_034169414 type 4 pilus major pilin -
LNN29_RS24790 (LNN29_24740) 34252..35361 - 1110 WP_000974903 type II secretion system F family protein -
LNN29_RS24795 (LNN29_24745) 35352..36890 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
LNN29_RS24800 (LNN29_24750) 36915..37409 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
LNN29_RS24805 (LNN29_24755) 37393..38703 - 1311 WP_001454111 type 4b pilus protein PilO2 -
LNN29_RS24810 (LNN29_24760) 38754..40397 - 1644 WP_001035592 PilN family type IVB pilus formation outer membrane protein -
LNN29_RS24815 (LNN29_24765) 40390..40926 - 537 WP_001220543 sigma 54-interacting transcriptional regulator virb4
LNN29_RS24820 (LNN29_24770) 40973..42931 - 1959 WP_229321795 type IV secretory system conjugative DNA transfer family protein -
LNN29_RS24825 (LNN29_24775) 42947..44002 - 1056 WP_001542006 P-type DNA transfer ATPase VirB11 virB11
LNN29_RS24830 (LNN29_24780) 44021..45160 - 1140 WP_034169415 TrbI/VirB10 family protein virB10
LNN29_RS24835 (LNN29_24785) 45150..45851 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
LNN29_RS24840 (LNN29_24790) 45917..46651 - 735 WP_000432282 type IV secretion system protein virB8
LNN29_RS24845 (LNN29_24795) 46817..49174 - 2358 WP_000548950 VirB4 family type IV secretion system protein virb4
LNN29_RS24850 (LNN29_24800) 49180..49500 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
LNN29_RS24855 (LNN29_24805) 49571..49861 - 291 WP_000865479 conjugal transfer protein -
LNN29_RS24860 (LNN29_24810) 49861..50445 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
LNN29_RS24865 (LNN29_24815) 50466..50864 - 399 WP_001153669 hypothetical protein -
LNN29_RS24870 (LNN29_24820) 50983..51420 - 438 WP_034169416 type IV pilus biogenesis protein PilM -
LNN29_RS24875 (LNN29_24825) 51426..52661 - 1236 WP_034169417 toxin co-regulated pilus biosynthesis Q family protein -
LNN29_RS24880 (LNN29_24830) 52664..52963 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
LNN29_RS24885 (LNN29_24835) 53011..53820 + 810 WP_024237698 DUF5710 domain-containing protein -
LNN29_RS24890 (LNN29_24840) 54043..54267 - 225 WP_000713562 EexN family lipoprotein -
LNN29_RS24895 (LNN29_24845) 54276..54920 - 645 WP_001310442 type IV secretion system protein -
LNN29_RS24900 (LNN29_24850) 54926..55921 - 996 WP_001028540 type IV secretion system protein virB6
LNN29_RS24905 (LNN29_24855) 55925..56182 - 258 WP_000739144 hypothetical protein -
LNN29_RS24910 (LNN29_24860) 56179..56481 - 303 WP_001360345 hypothetical protein -
LNN29_RS24915 (LNN29_24865) 56462..56719 - 258 WP_001542015 hypothetical protein -
LNN29_RS24920 (LNN29_24870) 56752..57198 - 447 WP_001243165 hypothetical protein -
LNN29_RS24925 (LNN29_24875) 57209..57379 - 171 WP_000550720 hypothetical protein -
LNN29_RS24930 (LNN29_24880) 57383..57826 - 444 WP_229321796 NfeD family protein -
LNN29_RS24935 (LNN29_24885) 58200..59153 - 954 WP_072089442 SPFH domain-containing protein -
LNN29_RS24940 (LNN29_24890) 59180..59356 - 177 WP_000753050 hypothetical protein -
LNN29_RS24945 (LNN29_24895) 59349..59564 - 216 WP_001127357 DUF1187 family protein -
LNN29_RS24950 (LNN29_24900) 59557..60009 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   8267 GenBank   NZ_CP086608
Plasmid name   pEF45-4 Incompatibility group   IncI2
Plasmid size   61140 bp Coordinate of oriT [Strand]   13731..13783 [-]
Host baterium   Escherichia fergusonii strain EF20JDJ4045

Cargo genes


Drug resistance gene   mcr-1.1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -