Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 107832 |
Name | oriT_pEF45-4 |
Organism | Escherichia fergusonii strain EF20JDJ4045 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP086608 (13731..13783 [-], 53 nt) |
oriT length | 53 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pEF45-4
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 5502 | GenBank | WP_229321795 |
Name | t4cp2_LNN29_RS24820_pEF45-4 | UniProt ID | _ |
Length | 652 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73492.13 Da Isoelectric Point: 9.3476
>WP_229321795.1 type IV secretory system conjugative DNA transfer family protein [Escherichia fergusonii]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVLLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGEKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVLLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGEKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 33091..55921
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LNN29_RS24760 (LNN29_24710) | 28133..29257 | - | 1125 | WP_000486716 | site-specific integrase | - |
LNN29_RS24765 (LNN29_24715) | 30221..30418 | + | 198 | WP_001356717 | hypothetical protein | - |
LNN29_RS24770 (LNN29_24720) | 31240..32439 | - | 1200 | Protein_38 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
LNN29_RS24775 (LNN29_24725) | 32452..33087 | - | 636 | WP_000934977 | A24 family peptidase | - |
LNN29_RS24780 (LNN29_24730) | 33091..33573 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
LNN29_RS24785 (LNN29_24735) | 33639..34202 | - | 564 | WP_034169414 | type 4 pilus major pilin | - |
LNN29_RS24790 (LNN29_24740) | 34252..35361 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
LNN29_RS24795 (LNN29_24745) | 35352..36890 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
LNN29_RS24800 (LNN29_24750) | 36915..37409 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
LNN29_RS24805 (LNN29_24755) | 37393..38703 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
LNN29_RS24810 (LNN29_24760) | 38754..40397 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
LNN29_RS24815 (LNN29_24765) | 40390..40926 | - | 537 | WP_001220543 | sigma 54-interacting transcriptional regulator | virb4 |
LNN29_RS24820 (LNN29_24770) | 40973..42931 | - | 1959 | WP_229321795 | type IV secretory system conjugative DNA transfer family protein | - |
LNN29_RS24825 (LNN29_24775) | 42947..44002 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
LNN29_RS24830 (LNN29_24780) | 44021..45160 | - | 1140 | WP_034169415 | TrbI/VirB10 family protein | virB10 |
LNN29_RS24835 (LNN29_24785) | 45150..45851 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
LNN29_RS24840 (LNN29_24790) | 45917..46651 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
LNN29_RS24845 (LNN29_24795) | 46817..49174 | - | 2358 | WP_000548950 | VirB4 family type IV secretion system protein | virb4 |
LNN29_RS24850 (LNN29_24800) | 49180..49500 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
LNN29_RS24855 (LNN29_24805) | 49571..49861 | - | 291 | WP_000865479 | conjugal transfer protein | - |
LNN29_RS24860 (LNN29_24810) | 49861..50445 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
LNN29_RS24865 (LNN29_24815) | 50466..50864 | - | 399 | WP_001153669 | hypothetical protein | - |
LNN29_RS24870 (LNN29_24820) | 50983..51420 | - | 438 | WP_034169416 | type IV pilus biogenesis protein PilM | - |
LNN29_RS24875 (LNN29_24825) | 51426..52661 | - | 1236 | WP_034169417 | toxin co-regulated pilus biosynthesis Q family protein | - |
LNN29_RS24880 (LNN29_24830) | 52664..52963 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
LNN29_RS24885 (LNN29_24835) | 53011..53820 | + | 810 | WP_024237698 | DUF5710 domain-containing protein | - |
LNN29_RS24890 (LNN29_24840) | 54043..54267 | - | 225 | WP_000713562 | EexN family lipoprotein | - |
LNN29_RS24895 (LNN29_24845) | 54276..54920 | - | 645 | WP_001310442 | type IV secretion system protein | - |
LNN29_RS24900 (LNN29_24850) | 54926..55921 | - | 996 | WP_001028540 | type IV secretion system protein | virB6 |
LNN29_RS24905 (LNN29_24855) | 55925..56182 | - | 258 | WP_000739144 | hypothetical protein | - |
LNN29_RS24910 (LNN29_24860) | 56179..56481 | - | 303 | WP_001360345 | hypothetical protein | - |
LNN29_RS24915 (LNN29_24865) | 56462..56719 | - | 258 | WP_001542015 | hypothetical protein | - |
LNN29_RS24920 (LNN29_24870) | 56752..57198 | - | 447 | WP_001243165 | hypothetical protein | - |
LNN29_RS24925 (LNN29_24875) | 57209..57379 | - | 171 | WP_000550720 | hypothetical protein | - |
LNN29_RS24930 (LNN29_24880) | 57383..57826 | - | 444 | WP_229321796 | NfeD family protein | - |
LNN29_RS24935 (LNN29_24885) | 58200..59153 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
LNN29_RS24940 (LNN29_24890) | 59180..59356 | - | 177 | WP_000753050 | hypothetical protein | - |
LNN29_RS24945 (LNN29_24895) | 59349..59564 | - | 216 | WP_001127357 | DUF1187 family protein | - |
LNN29_RS24950 (LNN29_24900) | 59557..60009 | - | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
ID | 8267 | GenBank | NZ_CP086608 |
Plasmid name | pEF45-4 | Incompatibility group | IncI2 |
Plasmid size | 61140 bp | Coordinate of oriT [Strand] | 13731..13783 [-] |
Host baterium | Escherichia fergusonii strain EF20JDJ4045 |
Cargo genes
Drug resistance gene | mcr-1.1 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |