Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   107631
Name   oriT_NW831|unnamed in_silico
Organism   Neisseria musculi strain NW831
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP060415 (4412..4454 [-], 43 nt)
oriT length   43 nt
IRs (inverted repeats)      7..12, 23..28  (GTTTCT..AGAAAC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 43 nt

>oriT_NW831|unnamed
CGCACTGTTTCTACTCGAAGAGAGAAACGTCTAAGTACGCCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5126 GenBank   WP_187001768
Name   MobA_MobL_H7A79_RS14580_NW831|unnamed insolico UniProt ID   _
Length   255 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 255 a.a.        Molecular weight: 29028.61 Da        Isoelectric Point: 9.7106

>WP_187001768.1 MobA/MobL family protein [Neisseria musculi]
MATAHLSVKVGKAGKGTPHAEYISRTGKYAKKLEQGEKLEATESGNMPAWAEENPLTFWQAADQYERANG
TVYREHEIALPRELTAEQRAELVREWVHHELGDCHAYIWAIHNKTALDGKPQPHVHLMYSERMNDGIERD
PEQYFRRYNPKYPERGGAKKHRSGETPTERKAALTAQRERWEKLHNAHIDRHLPKTTLLEASRNHRAKIS
MKSLAEQGIDRQAAAKMTPSESAAMHRKAAADRAAQQAIDSIRAF

  Protein domains


Predicted by InterproScan.

MobA/MobL family (MobA_MobL)

(21-234)


  Protein structure



No available structure.




Host bacterium

ID   8066 GenBank   NZ_CP060415
Plasmid name   NW831|unnamed Incompatibility group   -
Plasmid size   4650 bp Coordinate of oriT [Strand]   4412..4454 [-]
Host baterium   Neisseria musculi strain NW831

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -