Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   107590
Name   oriT_C-21-18|unnamed1 in_silico
Organism   Klebsiella oxytoca strain C-21-18
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP093272 (174149..174230 [-], 82 nt)
oriT length   82 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_C-21-18|unnamed1
GGGACAGGATGTGATTTGTTGAACCGCCACCACGGTGTCGGCCCCAACAAATCTCCTGGTCAGGGCAGAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5100 GenBank   WP_049593947
Name   Relaxase_MN553_RS28690_C-21-18|unnamed1 insolico UniProt ID   A0A2J5PVP5
Length   623 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 623 a.a.        Molecular weight: 71450.50 Da        Isoelectric Point: 8.8378

>WP_049593947.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Klebsiella]
MIAKVPDGRRDGRSSFLQLITYNCIRDELSPEEALREDARFRRPSRSREACFERLVEYIDRSQNAGEGEG
TEIMLENGDSRIAVNGVVIQHNCFSLKTAPVEMAATAMANRRCEEPVFHYILSWQEDENPDPDIIFSCVA
DTQKALGLEGNQYVAAIHRDTDNVHVHIATNRVCPRTFKAATLSFSKERLQRSCRQLELKHGFRHDNGSW
KVDEKGHVVRAKKRMKVLPEGAARLEHFADTESLTTYARQHCFEQIDRLLSGPHFSWGAAHEILCAAGLC
LDRKGEGLAIYSLYDTAQTPIRASRLHPDLTLKQEATAGAFQSPDWYPDSHNRYRNTLHVRDQGARAERR
EARANARLELRARYERYRRDWKKPDLDVAGRFRAIAAEARDRKAEVRRRGRTADPQIRRLAYNIIAFEKM
QKEAALRLQLREERATLHVAGKLRPMTYRGWVEQEAVKGDVAAISQLRGWHYRSKRKGFPTNSIVYCAPA
DDVGIMEAPEFEATVRRDGVVVYCRNGWAEVADYGDRLEVVTPKEIPSMWFAVGAASLKSGEHVSFSNDP
DFRTRACRTVAEFNREFPSRRLALQEPEQRRIVEAEQNRYTSQEQPRRQEQQDSPQGGMVWKP

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(52-312)


  Protein structure


Source ID Structure
AlphaFold DB A0A2J5PVP5


T4CP

ID   5320 GenBank   WP_049593958
Name   trbC_MN553_RS28610_C-21-18|unnamed1 insolico UniProt ID   _
Length   719 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 719 a.a.        Molecular weight: 81251.56 Da        Isoelectric Point: 7.4534

>WP_049593958.1 F-type conjugative transfer protein TrbC [Klebsiella oxytoca]
MNKPAVDTRRVNREVWQDGLSGLLFTPEIFLLVIVITTCIGWFFPATWLLSGPFLVLCVPIVLGNPWRMP
MRMPATMNRPDPSTDIAVRYRFVSWLPFGGIRIRRNPGAGILYLGFQRLKDAGRELWLSMDDLTRHTLFL
GTTGAGKTEFLLGVCLNALCWGKGFSFTDGKAQNDVAFAIGSLARRFGREDDVRYLNFITGGRSRAQALL
DNDRRRPQTNTINNFAIAQETFIIQLMQSMLPQVGGSDGGWQEKAKAMIQAMVMALCYLCRREQRIMSQR
ILVDYLPLKKVAQLYCQAVDEHWHDDARLPLENYLNLLAGFDISQVCRPSEWAPEALQQHGYLIQQFTRM
LTLFNDTYGHVFAEGAGDVELRDCLHNDRIVVVLIPALELESEEAATLGRLYYAQMAMILSQDLGEKIEG
PASDILVIRKFKDRFPFLIIGDEIGATYTDKIGELATQIRSLGYGLFLAGQDLQRLIVAAGKKTGTLLAN
MGTRIAGTTVDPEETLQVFSKAGGREFRAEMAAVERREGVIDTDWGESDQLQLREHDRIDLSELQALRPG
EIVTLFKGEPVRGAALYIADHDKLTRKSLHINRFIEVPAPTPSEMWEMLPHSARKCWPSPSIVSHLRRIL
GGYRNTAFVRYSPEHMTLTDDVLCRLADEEDRMAYILDTPRTQRGVRLYQTALNALRDKSGTRGRYRAES
TQLRQHTLPADVLRHLVSD

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(437-555)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 119588..155232

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MN553_RS28425 (MN553_28425) 114862..115851 + 990 WP_049593989 toxin co-regulated pilus biosynthesis Q family protein -
MN553_RS28430 (MN553_28430) 115854..116270 + 417 WP_049593988 type IV pilus biogenesis protein PilM -
MN553_RS28435 (MN553_28435) 116299..117945 + 1647 WP_053094426 PilN family type IVB pilus formation outer membrane protein -
MN553_RS28440 (MN553_28440) 117957..119189 + 1233 WP_049593987 type 4b pilus protein PilO2 -
MN553_RS28445 (MN553_28445) 119173..119595 + 423 WP_049593986 type IV pilus biogenesis protein PilP -
MN553_RS28450 (MN553_28450) 119588..121108 + 1521 WP_049593985 ATPase, T2SS/T4P/T4SS family virB11
MN553_RS28455 (MN553_28455) 121101..122177 + 1077 WP_049593984 type II secretion system F family protein -
MN553_RS28460 (MN553_28460) 122232..122822 + 591 WP_077260796 type 4 pilus major pilin -
MN553_RS28465 (MN553_28465) 122869..123369 + 501 WP_049593983 lytic transglycosylase domain-containing protein virB1
MN553_RS28470 (MN553_28470) 123359..123985 + 627 WP_049593982 prepilin peptidase -
MN553_RS28475 (MN553_28475) 124006..125472 + 1467 WP_023321932 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
MN553_RS28480 (MN553_28480) 126324..127442 + 1119 WP_049593981 site-specific integrase -
MN553_RS28485 (MN553_28485) 127516..128031 + 516 WP_148677624 hypothetical protein -
MN553_RS28490 (MN553_28490) 128021..128491 + 471 WP_049593979 lytic transglycosylase domain-containing protein virB1
MN553_RS28495 (MN553_28495) 128501..128959 + 459 WP_049593978 DotD/TraH family lipoprotein -
MN553_RS28500 (MN553_28500) 128956..129732 + 777 WP_049593977 type IV secretory system conjugative DNA transfer family protein traI
MN553_RS28505 (MN553_28505) 129967..130869 + 903 WP_049593976 GNAT family N-acetyltransferase -
MN553_RS28510 (MN553_28510) 130939..131775 - 837 WP_049593975 alpha/beta hydrolase -
MN553_RS28515 (MN553_28515) 132017..133171 + 1155 WP_049593974 plasmid transfer ATPase TraJ virB11
MN553_RS28520 (MN553_28520) 133168..133431 + 264 WP_049593973 hypothetical protein traK
MN553_RS28525 (MN553_28525) 133450..136575 + 3126 WP_049593972 LPD7 domain-containing protein -
MN553_RS28530 (MN553_28530) 136586..136933 + 348 WP_049593971 hypothetical protein traL
MN553_RS28535 (MN553_28535) 136950..137633 + 684 WP_023321918 DotI/IcmL/TraM family protein traM
MN553_RS28540 (MN553_28540) 137642..138634 + 993 WP_049593970 DotH/IcmK family type IV secretion protein traN
MN553_RS28545 (MN553_28545) 138640..139899 + 1260 WP_049593969 conjugal transfer protein TraO traO
MN553_RS28550 (MN553_28550) 139896..140660 + 765 WP_049593968 hypothetical protein traP
MN553_RS28555 (MN553_28555) 140670..141197 + 528 WP_023321914 conjugal transfer protein TraQ traQ
MN553_RS28560 (MN553_28560) 141243..141659 + 417 WP_049593967 DUF6750 family protein traR
MN553_RS28565 (MN553_28565) 141656..142162 + 507 WP_049593966 hypothetical protein traT
MN553_RS28570 (MN553_28570) 142218..145268 + 3051 WP_049593965 conjugal transfer protein traU
MN553_RS28575 (MN553_28575) 145329..146516 + 1188 WP_049593964 conjugal transfer protein TraW traW
MN553_RS28580 (MN553_28580) 146506..147033 + 528 WP_049593963 conjugal transfer protein TraX -
MN553_RS28970 147404..147463 + 60 Protein_147 DinQ-like type I toxin DqlB -
MN553_RS28975 148117..148212 + 96 WP_275955679 DinQ-like type I toxin DqlB -
MN553_RS28585 (MN553_28585) 148349..150496 + 2148 WP_049593962 DotA/TraY family protein traY
MN553_RS28590 (MN553_28590) 150605..151198 + 594 WP_148677622 plasmid IncI1-type surface exclusion protein ExcA -
MN553_RS28595 (MN553_28595) 151859..152605 + 747 WP_049593960 methyltransferase domain-containing protein -
MN553_RS28600 (MN553_28600) 153256..154383 + 1128 WP_053094425 hypothetical protein trbA
MN553_RS28605 (MN553_28605) 154402..155232 + 831 WP_049593959 thioredoxin fold domain-containing protein trbB
MN553_RS28610 (MN553_28610) 155225..157384 + 2160 WP_049593958 F-type conjugative transfer protein TrbC -
MN553_RS28615 (MN553_28615) 157394..157903 + 510 WP_049593957 phospholipase D family protein -
MN553_RS28620 (MN553_28620) 158008..158442 + 435 WP_049593956 VOC family protein -
MN553_RS28625 (MN553_28625) 158470..158642 + 173 Protein_157 hypothetical protein -
MN553_RS28630 (MN553_28630) 158797..160227 - 1431 WP_049593955 aspartyl protease family protein -

Host bacterium

ID   8025 GenBank   NZ_CP093272
Plasmid name   C-21-18|unnamed1 Incompatibility group   IncFIB
Plasmid size   200578 bp Coordinate of oriT [Strand]   174149..174230 [-]
Host baterium   Klebsiella oxytoca strain C-21-18

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   arsR, arsD, arsA, arsB, arsC, pcoE, pcoS, pcoR, pcoD, pcoC, pcoB, pcoA, silP, silA, silB, silF, silC, silR, silS, silE, fecD, fecE, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -