Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   107542
Name   oriT_pKLCA in_silico
Organism   Weissella cibaria
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_010078 (30..62 [+], 33 nt)
oriT length   33 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 33 nt

>oriT_pKLCA
ACCGCCCAATTTTGGAGTGGTGTGTAAGTGCGC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   5059 GenBank   WP_012211167
Name   Rep_trans_HS168_RS00005_pKLCA insolico UniProt ID   Q84FN9
Length   257 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 257 a.a.        Molecular weight: 30394.27 Da        Isoelectric Point: 5.0076

>WP_012211167.1 replication initiation factor domain-containing protein [Weissella cibaria]
MNALGSSWELSDGVFRLIREYPNGDTENIAYYAENAFQAGSWRLDFNPNKLSDEEKLEMNRAIDLLTDVH
FTRLDLAFDVFNNELGMKYRIYRPSVSQREYVVYTAQWTKAVETSILRGLTGSEQQIRQYNKLVEQTKKK
MPLPDGVEHWMRLELQLRGRKPAEWVERAKGMLDDFRLPNYDRIQNKNDRMALFALENGLLDWSDFSDKN
KKARLRKLQKEQYDDTLSQELLDLLIAHQERLHEELTSYLAEFDIQE

  Protein domains


Predicted by InterproScan.

Replication initiation factor (Rep_trans)

(70-170)


  Protein structure


Source ID Structure
AlphaFold DB Q84FN9


Host bacterium

ID   7977 GenBank   NC_010078
Plasmid name   pKLCA Incompatibility group   -
Plasmid size   1490 bp Coordinate of oriT [Strand]   30..62 [+]
Host baterium   Weissella cibaria

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -