Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   107526
Name   oriT_p2246-CTXM in_silico
Organism   Shigella boydii strain 2246
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KX646543 (70587..70672 [-], 86 nt)
oriT length   86 nt
IRs (inverted repeats)      61..68, 73..80  (TTGGTGGT..ACCACCAA)
 27..34, 37..44  (GCAAAAAC..GTTTTTGC)
 8..14, 20..26  (TGATTTA..TAAATCA)
Location of nic site      53..54
Conserved sequence flanking the
  nic site  
 
 TGTGTGGTGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 86 nt

>oriT_p2246-CTXM
AATTACATGATTTAAAACGTAAATCAGCAAAAACTTGTTTTTGCGTAGTGTGTGGTGCTTTTGGTGGTGAGAACCACCAACCTGTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   2319 GenBank   WP_001354030
Name   WP_001354030_p2246-CTXM insolico UniProt ID   A0A734M5H3
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14508.47 Da        Isoelectric Point: 4.7116

>WP_001354030.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MARVILYISNDVYDKVNAIVEQRRQEGARDKDISVSGTASMLLELGLRVYEAQMERKESAFNQTEFNKLL
LECVVKTQSSVAKILGIESLSPHVSGNPKFEYANMVEDIREKVSSEMERFFPKNDEE

  Protein domains


Predicted by InterproScan.

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A734M5H3

ID   2320 GenBank   WP_000089263
Name   WP_000089263_p2246-CTXM insolico UniProt ID   A0A3U3XJL9
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 8541.74 Da        Isoelectric Point: 8.6796

>WP_000089263.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MSRNIIRPAPGNKVLLVLDDATNHKLLGARERSGRTKTNEVLVRLRDHLNRFPDFYNLDAIKEGAEETDS
IIKDL

  Protein domains


Predicted by InterproScan.

(14-60)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U3XJL9


T4CP


ID   5272 GenBank   WP_000069777
Name   traC_HPF80_RS00590_p2246-CTXM insolico UniProt ID   _
Length   876 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 876 a.a.        Molecular weight: 99195.86 Da        Isoelectric Point: 6.1126

>WP_000069777.1 MULTISPECIES: type IV secretion system protein TraC [Enterobacteriaceae]
MSNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAI
PINGANKSIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAA
ATQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASIATQTVDAQAFIDIV
GEMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLNVRADYLTLGLRENGRNSTARILNFHLARNPEIAF
LWNMADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWG
ELRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGK
GLFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSG
AGKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLS
VMASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAGSPTIRSRLDEMIVLLDQY
TANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGW
RLLDFKNRKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKY
NQLYPDQFQPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEG
LSIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(290-447)

(468-764)

(39-277)

  Protein structure



No available structure.



ID   5273 GenBank   WP_125097878
Name   traD_HPF80_RS00690_p2246-CTXM insolico UniProt ID   _
Length   762 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 762 a.a.        Molecular weight: 86727.59 Da        Isoelectric Point: 5.1644

>WP_125097878.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIASMRIRMFSQIANIMLYCLFIFFWILIGLVLWVKISWQTFINGCIYWWCTSLEGMR
DLIKSQPVYEIQYYGKTFRMNAAQVLHDKYMIWCGEQLWSAFVLASVVALVICLITFFVVSWILGRQGKQ
QSENEVTGGRQLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYAR
QRGDMVVIYDRSGEFVKSYYDPSIDKILNPLDARCAAWDLWKECLTQPDFDNTANTLIPMGTKEDPFWQG
SGRTIFAEAAYLMRNDPNRSYSKLVDTLLSIKIEKLRTFLRNSPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEHNGDPFTIRDWMRGVREDQKNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WFFCDELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGEKAAATLFDVMNTRAFFRSPSHKIA
EFAAGEIGEKEHLKASEQYSYGADPVRDGVSTGKDMERQTLVSYSDIQSLPDLTCYVTLPGPYPAVKLSL
KYQARPKVAPEFIPRDINPEMENRLSAVLAAREAEGRQMASLFEPEVASGEDVTQAEQPQQPQQPQQPQQ
PQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPQQPVSSVINDKKSDAGVSVPAGGIEQELKMKPE
EEMEQQLPPGISESGEVVDMAAYEAWQQENHPDIQQHMQRREEVNINVHRERGEDVEPGDDF

  Protein domains


Predicted by InterproScan.

(173-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 70019..101772

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HPF80_RS00460 65400..65630 + 231 WP_000218642 hypothetical protein -
HPF80_RS00465 65682..67043 + 1362 WP_000170695 DUF3560 domain-containing protein -
HPF80_RS00470 67090..67653 + 564 WP_001298559 class I SAM-dependent methyltransferase -
HPF80_RS00745 67739..68194 - 456 Protein_90 hypothetical protein -
HPF80_RS00485 68494..68790 + 297 WP_001272251 hypothetical protein -
HPF80_RS00490 68901..69722 + 822 WP_001234445 DUF932 domain-containing protein -
HPF80_RS00495 70019..70609 - 591 WP_000252683 transglycosylase SLT domain-containing protein virB1
HPF80_RS00500 70944..71327 + 384 WP_001354030 conjugal transfer relaxosome DNA-binding protein TraM -
HPF80_RS00505 71521..72153 + 633 WP_171265063 conjugal transfer transcriptional regulator TraJ -
HPF80_RS00510 72242..73470 + 1229 WP_088895425 IS3-like element IS2 family transposase -
HPF80_RS00515 73665..73892 + 228 WP_000089263 conjugal transfer relaxosome protein TraY -
HPF80_RS00520 73925..74284 + 360 WP_001098992 type IV conjugative transfer system pilin TraA -
HPF80_RS00525 74299..74610 + 312 WP_000012113 type IV conjugative transfer system protein TraL traL
HPF80_RS00530 74632..75198 + 567 WP_000399780 type IV conjugative transfer system protein TraE traE
HPF80_RS00535 75185..75913 + 729 WP_001230772 type-F conjugative transfer system secretin TraK traK
HPF80_RS00540 75913..77364 + 1452 WP_134265680 F-type conjugal transfer pilus assembly protein TraB traB
HPF80_RS00545 77354..77920 + 567 WP_000896599 conjugal transfer pilus-stabilizing protein TraP -
HPF80_RS00550 77907..78227 + 321 WP_001057307 conjugal transfer protein TrbD -
HPF80_RS00555 78224..78739 + 516 WP_000809881 type IV conjugative transfer system lipoprotein TraV traV
HPF80_RS00560 78874..79095 + 222 WP_001278683 conjugal transfer protein TraR -
HPF80_RS00565 79131..80099 + 969 WP_000654804 IS5-like element IS903B family transposase -
HPF80_RS00570 80139..80567 + 429 WP_089438737 hypothetical protein -
HPF80_RS00575 80560..81033 + 474 WP_000549568 hypothetical protein -
HPF80_RS00580 81113..81331 + 219 WP_000556745 hypothetical protein -
HPF80_RS00750 81359..81707 + 349 Protein_111 hypothetical protein -
HPF80_RS00590 81833..84463 + 2631 WP_000069777 type IV secretion system protein TraC virb4
HPF80_RS00595 84460..84846 + 387 WP_000214084 type-F conjugative transfer system protein TrbI -
HPF80_RS00600 84843..85475 + 633 WP_094885485 type-F conjugative transfer system protein TraW traW
HPF80_RS00605 85472..86464 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
HPF80_RS00610 86494..86799 + 306 WP_000224416 hypothetical protein -
HPF80_RS00615 86808..87446 + 639 WP_001080256 type-F conjugative transfer system pilin assembly protein TrbC trbC
HPF80_RS00620 87443..89293 + 1851 WP_171265065 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HPF80_RS00625 89320..89577 + 258 WP_000864353 conjugal transfer protein TrbE -
HPF80_RS00630 89570..90313 + 744 WP_001030371 type-F conjugative transfer system pilin assembly protein TraF traF
HPF80_RS00635 90327..90671 + 345 WP_000556796 conjugal transfer protein TrbA -
HPF80_RS00640 90790..91074 + 285 WP_000624194 type-F conjugative transfer system pilin chaperone TraQ -
HPF80_RS00645 91061..91606 + 546 WP_000059831 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HPF80_RS00755 91563..91658 + 96 Protein_124 conjugal transfer protein TrbJ -
HPF80_RS00655 92397..92660 + 264 WP_171265066 conjugal transfer protein TrbJ -
HPF80_RS00660 92641..93033 + 393 WP_000660699 F-type conjugal transfer protein TrbF -
HPF80_RS00665 93020..94393 + 1374 WP_000944331 conjugal transfer pilus assembly protein TraH traH
HPF80_RS00670 94390..97212 + 2823 WP_001007039 conjugal transfer mating-pair stabilization protein TraG traG
HPF80_RS00675 97228..97713 + 486 WP_000605870 hypothetical protein -
HPF80_RS00680 97762..98493 + 732 WP_000782451 conjugal transfer complement resistance protein TraT -
HPF80_RS00685 98696..99433 + 738 WP_000199905 hypothetical protein -
HPF80_RS00690 99484..101772 + 2289 WP_125097878 type IV conjugative transfer system coupling protein TraD prgC


Host bacterium


ID   7961 GenBank   NZ_KX646543
Plasmid name   p2246-CTXM Incompatibility group   IncFII
Plasmid size   111559 bp Coordinate of oriT [Strand]   70587..70672 [-]
Host baterium   Shigella boydii strain 2246

Cargo genes


Drug resistance gene   erm(B), mph(A), cmlA1, qacE, blaCTX-M-14
Virulence gene   -
Metal resistance gene   merR, merT, merP, merA, merD, merE
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -