Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   107435
Name   oriT_IncI2 in_silico
Organism   Salmonella enterica strain STH21
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_LN623683 (7377..7429 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_IncI2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   5172 GenBank   WP_000338974
Name   t4cp2_HXH36_RS00195_IncI2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73347.89 Da        Isoelectric Point: 9.1391

>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 23269..46814

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HXH36_RS00130 18594..19247 - 654 WP_015387348 hypothetical protein -
HXH36_RS00135 19259..20383 - 1125 WP_000486719 site-specific integrase -
HXH36_RS00140 20718..20978 - 261 WP_198965019 pilus assembly protein -
HXH36_RS00145 21373..22617 - 1245 WP_015387351 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HXH36_RS00150 22630..23265 - 636 WP_000934978 A24 family peptidase -
HXH36_RS00155 23269..23697 - 429 WP_001326801 lytic transglycosylase domain-containing protein virB1
HXH36_RS00160 23818..24375 - 558 WP_000095051 type 4 pilus major pilin -
HXH36_RS00165 24420..25529 - 1110 WP_000974900 type II secretion system F family protein -
HXH36_RS00170 25520..27058 - 1539 WP_001420475 ATPase, T2SS/T4P/T4SS family virB11
HXH36_RS00175 27083..27577 - 495 WP_000912551 type IV pilus biogenesis protein PilP -
HXH36_RS00180 27561..28883 - 1323 WP_000454143 type 4b pilus protein PilO2 -
HXH36_RS00185 28922..30565 - 1644 WP_176455541 PilN family type IVB pilus formation outer membrane protein -
HXH36_RS00190 30558..31076 - 519 WP_015387353 YfdA protein virb4
HXH36_RS00195 31123..33081 - 1959 WP_000338974 type IV secretory system conjugative DNA transfer family protein -
HXH36_RS00200 33097..34152 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HXH36_RS00205 34171..35310 - 1140 WP_015387354 TrbI/VirB10 family protein virB10
HXH36_RS00210 35300..36001 - 702 WP_053882504 TrbG/VirB9 family P-type conjugative transfer protein -
HXH36_RS00215 36067..36801 - 735 WP_000432282 type IV secretion system protein virB8
HXH36_RS00220 36965..39322 - 2358 WP_015387356 VirB4 family type IV secretion system protein virb4
HXH36_RS00225 39328..39648 - 321 WP_000362081 VirB3 family type IV secretion system protein virB3
HXH36_RS00430 39719..40009 - 291 WP_000865479 conjugal transfer protein -
HXH36_RS00235 40009..40593 - 585 WP_001401693 lytic transglycosylase domain-containing protein virB1
HXH36_RS00240 40614..41012 - 399 WP_001708012 hypothetical protein -
HXH36_RS00245 41352..41789 - 438 WP_015387358 type IV pilus biogenesis protein PilM -
HXH36_RS00250 41795..43030 - 1236 WP_001419735 TcpQ domain-containing protein -
HXH36_RS00255 43033..43332 - 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
HXH36_RS00260 43399..44031 - 633 WP_001419736 hypothetical protein -
HXH36_RS00265 44079..44888 + 810 WP_001419737 DUF5710 domain-containing protein -
HXH36_RS00270 44935..45171 - 237 WP_000750964 EexN family lipoprotein -
HXH36_RS00275 45175..45822 - 648 WP_001419738 type IV secretion system protein -
HXH36_RS00280 45828..46814 - 987 WP_001419739 type IV secretion system protein virB6
HXH36_RS00285 46818..47075 - 258 WP_000739144 hypothetical protein -
HXH36_RS00290 47072..47374 - 303 WP_001360345 hypothetical protein -
HXH36_RS00295 47390..47641 - 252 WP_015387362 hypothetical protein -
HXH36_RS00300 47638..47820 - 183 WP_022540746 hypothetical protein -
HXH36_RS00305 47789..48451 - 663 WP_001419740 hypothetical protein -
HXH36_RS00310 48462..48632 - 171 WP_000550721 hypothetical protein -
HXH36_RS00315 48636..49079 - 444 WP_000964840 NfeD family protein -
HXH36_RS00320 49152..50032 - 881 Protein_62 SPFH domain-containing protein -
HXH36_RS00325 50078..50272 - 195 WP_000049865 DUF1187 family protein -
HXH36_RS00330 50265..50771 - 507 WP_001358485 CaiF/GrlA family transcriptional regulator -
HXH36_RS00335 51415..51774 - 360 WP_015387332 hypothetical protein -


Host bacterium


ID   7870 GenBank   NZ_LN623683
Plasmid name   IncI2 Incompatibility group   IncI2
Plasmid size   62139 bp Coordinate of oriT [Strand]   7377..7429 [-]
Host baterium   Salmonella enterica strain STH21

Cargo genes


Drug resistance gene   blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -