Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   107324
Name   oriT_pLD-TEX-KL in_silico
Organism   Fluoribacter dumoffii Tex-KL
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_009966 (28883..28915 [+], 33 nt)
oriT length   33 nt
IRs (inverted repeats)      3..9, 13..19  (ACGTTGC..GCAACGT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 33 nt

>oriT_pLD-TEX-KL
GCACGTTGCAACGCAACGTATAAGCGCGCACTT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   5071 GenBank   WP_012187529
Name   traD_HXC02_RS00135_pLD-TEX-KL insolico UniProt ID   _
Length   621 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 621 a.a.        Molecular weight: 71124.44 Da        Isoelectric Point: 7.1593

>WP_012187529.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Legionellaceae]
MNNEPNFKHYTRGGQISFHNLRMWDQITKTLSMICLIFWIVFTLVFVWFFISLEKITHAVIFYYAQFLEI
VGQKHTFELSFHGKTYKQTVDSILNYAYYQDNANHVIHSLGKSALWAFCLSFILGLCLAYYFIKRGKAQS
DSQFVRGSQFKHSNVVKKKILRDKAHSDITIDTFPLIKNSEVQHVLVHGTVGTGKSQLIMKIMDCLRKRG
DRVIVYDKGCSFIAHYYQDESDVILNPFDKRCANWDMWLEAPRDSDFENMAESSIPMHGESDPFWVNASR
TVFSCLGSVMRHHSDRSVEKLLKLILTDEFSDLEEYLQGTPAATLVSSKIEKTAISIRATLTTYLKSFSA
LAELNQEGKPPFSIRDYILDEQQKGWLFISSNGETHKSLKPLISMWLAQASLALLSLTPDRNRRIWFICD
ELPSLHKLPLLGETIAEVRKFGGCFLLGMQSFSQLTKVYGQAGGREIFDLLNTRFFFRSPSSDMARLVAS
ELGEEEIEESRENYSYGANSIRDGISLGAQRVTRPIVSYPQIMELKDLHCFVRLPGHYPITQLTLDLGFR
TIKTNGFIERNMPTTFNFSQLTSIDEDWESGTDGHVGSKQPNKNKINAEHQCIEELNLEPL

  Protein domains


Predicted by InterproScan.

(169-555)

(35-126)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 7435..25432

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HXC02_RS00020 2793..3326 + 534 WP_058460589 hypothetical protein -
HXC02_RS00025 (pLDTEXKL_p05) 3295..4068 - 774 WP_058460590 VUT family protein -
HXC02_RS00030 (pLDTEXKL_p06) 4052..4711 - 660 WP_012187509 XRE family transcriptional regulator -
HXC02_RS00335 4911..5153 + 243 WP_012187510 TraY domain-containing protein -
HXC02_RS00040 (pLDTEXKL_p08) 5131..6222 + 1092 WP_012187511 hypothetical protein -
HXC02_RS00045 (pLDTEXKL_p09) 6273..7016 + 744 WP_012187512 complement resistance protein TraT -
HXC02_RS00050 (pLDTEXKL_p10) 7134..7421 + 288 WP_012187513 hypothetical protein -
HXC02_RS00055 (pLDTEXKL_p11) 7435..7731 + 297 WP_012187514 type IV conjugative transfer system protein TraL traL
HXC02_RS00060 (pLDTEXKL_p12) 7721..8311 + 591 WP_236942459 type IV conjugative transfer system protein TraE traE
HXC02_RS00065 (pLDTEXKL_p13) 8304..9023 + 720 WP_012187516 type-F conjugative transfer system secretin TraK traK
HXC02_RS00070 (pLDTEXKL_p14) 9016..10389 + 1374 WP_012187517 TrbI/VirB10 family protein traB
HXC02_RS00075 10449..10676 + 228 WP_231294685 conjugal transfer protein traV
HXC02_RS00080 (pLDTEXKL_p15) 10667..13264 + 2598 WP_012187518 type IV secretion system protein TraC virb4
HXC02_RS00085 (pLDTEXKL_p16) 13255..13590 + 336 WP_012187519 type-F conjugative transfer system protein TrbI -
HXC02_RS00090 (pLDTEXKL_p17) 13587..14222 + 636 WP_012187520 type-F conjugative transfer system protein TraW traW
HXC02_RS00095 (pLDTEXKL_p18) 14212..15195 + 984 WP_058460577 conjugal transfer pilus assembly protein TraU traU
HXC02_RS00100 (pLDTEXKL_p19) 15208..15630 + 423 WP_012187522 type-F conjugative transfer system pilin assembly protein TrbC trbC
HXC02_RS00105 (pLDTEXKL_p20) 15623..17311 + 1689 WP_012187523 conjugal transfer protein TraN traN
HXC02_RS00110 (pLDTEXKL_p21) 17304..18053 + 750 WP_012187524 type-F conjugative transfer system pilin assembly protein TraF traF
HXC02_RS00115 (pLDTEXKL_p22) 18050..18559 + 510 WP_012187525 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HXC02_RS00120 (pLDTEXKL_p23) 18559..19923 + 1365 WP_012187526 conjugal transfer protein TraH traH
HXC02_RS00125 (pLDTEXKL_p24) 19937..22786 + 2850 WP_012187527 conjugal transfer mating-pair stabilization protein TraG traG
HXC02_RS00130 (pLDTEXKL_p25) 22776..23567 + 792 WP_058387442 hypothetical protein -
HXC02_RS00135 (pLDTEXKL_p26) 23567..25432 + 1866 WP_012187529 type IV conjugative transfer system coupling protein TraD virb4
HXC02_RS00140 (pLDTEXKL_p27) 25517..26134 - 618 WP_012187530 hypothetical protein -
HXC02_RS00145 (pLDTEXKL_p28) 26145..28952 - 2808 WP_236942460 Ti-type conjugative transfer relaxase TraA -
HXC02_RS00150 (pLDTEXKL_p29) 29042..29332 + 291 WP_012187532 hypothetical protein -
HXC02_RS00155 (pLDTEXKL_p30) 29549..29857 + 309 WP_012187533 hypothetical protein -


Host bacterium


ID   7760 GenBank   NC_009966
Plasmid name   pLD-TEX-KL Incompatibility group   -
Plasmid size   66512 bp Coordinate of oriT [Strand]   28883..28915 [+]
Host baterium   Fluoribacter dumoffii Tex-KL

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA1, AcrIB