Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   107191
Name   oriT_pBHS24B in_silico
Organism   Bacillus paranthracis strain DB-4
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_KC991136 (4442..4479 [-], 38 nt)
oriT length   38 nt
IRs (inverted repeats)      1..6, 10..15  (CTTTAC..GTAAAG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 38 nt

>oriT_pBHS24B
CTTTACGAAGTAAAGTATAGTGCGTTATACTTTACATG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   4781 GenBank   WP_173051603
Name   mobV_HTA86_RS00010_pBHS24B insolico UniProt ID   _
Length   189 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 189 a.a.        Molecular weight: 22289.18 Da        Isoelectric Point: 10.0795

>WP_173051603.1 MobV family relaxase [Bacillus paranthracis]
MAKVKKNDIRGYQIHNLRELKSNTNPDIDPTRSHLNKDFINDQPINFKKKWEERIKEGYTLKREIRGDAT
RYNEFIIGSDKEFFDKLDQAEKDRFFKTATDFFTERYGKENVLYSIAHYDELRGAGAHAHVAVVPLKDGK
LTGKEVFDRKELRYLQEELPKALQRAGFDIERGREGSKAQHMKQPRSRR

  Protein domains


Predicted by InterproScan.

Plasmid recombination enzyme (Mob_Pre)

(1-184)


  Protein structure



No available structure.




Host bacterium

ID   7627 GenBank   NZ_KC991136
Plasmid name   pBHS24B Incompatibility group   -
Plasmid size   5837 bp Coordinate of oriT [Strand]   4442..4479 [-]
Host baterium   Bacillus paranthracis strain DB-4

Cargo genes

Drug resistance gene   erm(T)
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -