Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106985
Name   oriT_p48659_KPC in_silico
Organism   Morganella morganii strain MM48659
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP070535 (46259..46357 [+], 99 nt)
oriT length   99 nt
IRs (inverted repeats)      77..82, 89..94  (AAAAAA..TTTTTT)
 77..82, 88..93  (AAAAAA..TTTTTT)
 31..38, 41..48  (AGCGTGAT..ATCACGCT)
 17..23, 35..41  (TAAATCA..TGATTTA)
Location of nic site      59..60
Conserved sequence flanking the
  nic site  
 
 GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 99 nt

>oriT_p48659_KPC
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   4610 GenBank   WP_000130000
Name   Replic_Relax_JW294_RS00185_p48659_KPC insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium


ID   7422 GenBank   NZ_CP070535
Plasmid name   p48659_KPC Incompatibility group   IncP6
Plasmid size   62326 bp Coordinate of oriT [Strand]   46259..46357 [+]
Host baterium   Morganella morganii strain MM48659

Cargo genes


Drug resistance gene   aac(6')-Ib, blaKPC-2, mph(A), sul1, qacE, ARR-3, catB3, blaOXA-1, aac(6')-Ib-cr
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -