Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106974
Name   oriT_p50821_KPC in_silico
Organism   Morganella morganii strain MM50821
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP070550 (1318..1417 [-], 100 nt)
oriT length   100 nt
IRs (inverted repeats)      78..83, 90..95  (AAAAAA..TTTTTT)
 78..83, 89..94  (AAAAAA..TTTTTT)
 32..39, 42..49  (AGCGTGAT..ATCACGCT)
 18..24, 36..42  (TAAATCA..TGATTTA)
Location of nic site      60..61
Conserved sequence flanking the
  nic site    		  GGTGTATAGC
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 100 nt

>oriT_p50821_KPC
TTTGTTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   4605 GenBank   WP_000130000
Name   Replic_Relax_JW297_RS00070_p50821_KPC insolico UniProt ID   R4WML4
Length   101 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 101 a.a.        Molecular weight: 11477.11 Da        Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

  Protein domains


Predicted by InterproScan.

Transcriptional regulator PadR-like family (PadR)

(15-84)


  Protein structure


Source ID Structure
AlphaFold DB R4WML4


Host bacterium

ID   7411 GenBank   NZ_CP070550
Plasmid name   p50821_KPC Incompatibility group   IncR
Plasmid size   54347 bp Coordinate of oriT [Strand]   1318..1417 [-]
Host baterium   Morganella morganii strain MM50821

Cargo genes

Drug resistance gene   catB3, ARR-3, qacE, sul1, mph(A), blaKPC-2, aac(6')-Ib
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -