Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106973
Name   oriT_pL8 in_silico
Organism   Enterococcus faecalis strain L8
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP072508 (8948..9127 [+], 180 nt)
oriT length   180 nt
IRs (inverted repeats)      18..23, 30..35  (AGGAAA..TTTCCT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 180 nt

>oriT_pL8
GGGTAAAGGAAGAATTGAGGAAATAGAGGTTTCCTGTATTGAACCATATAGTCAAGTAATGTTCCATCTGGGATACGAGTTTGATGAAAATGATGCACATGATGTGAAGTTATTGTGTGAGACATTTCATATCGAAATTCCAAATGAGTATAGATAACTGCAAATAACAGTTTGTAGGGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   4698 GenBank   WP_086321360
Name   t4cp2_FOA09_RS14180_pL8 insolico UniProt ID   _
Length   752 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 752 a.a.        Molecular weight: 85966.37 Da        Isoelectric Point: 5.8623

>WP_086321360.1 TraM recognition domain-containing protein [Enterococcus faecalis]
MQGNNLFNNGLLQPKKPPIGQEQQKMTRYHQLRLVFGLVGVLLYPFAILGSIPLLIGLAVDKRDKAANVF
DMDYESFLKRNSIVFLSFSAVLLVINVFAFILWIPRGYLSAYLLFPLNLLHTALRFNWETIVALLIGSSG
MGAIFLAFSSFVAKRKVISKEDERKKITESKAYKDREKNKFEESQRFTDEQEEAYEEAVETVDIDKYKEL
SNQLLLGTSEFGLPYIINFSEFNQHVLVPATTGSGKTTLLQLLVQHAVKFNFPVILIDGKGARDTLESMR
EIAKFYDKEVHAFTDDGDMRYNPVEHGNDISIRDKLVSLAETESVFYSGAAKALLQVTIQLLDEFKGAKV
TLSGDTRTTETVERSLPFVQRFLLPRNVLHLFADAILPNNPKLFEIEVEKKIQQPKKKSVKEGSEIPPDS
DLDKEEKEEDSQIKNSKFRNISQLGIAQKETETIVLNPETLDLDSYYLLLKRNLRYLPTDKETGENIKQK
LFERLFIRYEHKDSPFYLYATSEALQTNINMLLDSELGKLFDTKNAKNVLDVQEIVNQRKLVYVSFNGLI
YKEYIRTLAQMLVGDVNYFASEMYRKNVKREVLVIFDEPASYLNETFIDMVNKGRGAGVYGIFTPQTMAD
IAKLGDKLMEQLVGNVNTLFIGKTNEKGEAEYWSETMGTYQDIDVTSVTEQEDGYSDVGKSDWSGDRGTK
RNVDRFKISPNKIKELRTGEFIIYRTAENVNLPPQKVYVRNALEWLQKSNSK

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(592-691)

Helicase HerA, central domain (DUF87)

(222-424)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 53383..73128

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FOA09_RS14150 (FOA09_15580) 48439..49773 - 1335 WP_001036756 PcfJ domain-containing protein -
FOA09_RS14155 (FOA09_15585) 49770..50546 - 777 WP_000347505 Cas9 inhibitor AcrIIA9 family protein -
FOA09_RS14160 (FOA09_15590) 50708..50974 - 267 WP_001245899 hypothetical protein -
FOA09_RS14165 (FOA09_15595) 50981..51163 - 183 WP_001808764 hypothetical protein -
FOA09_RS14170 (FOA09_15600) 51581..52069 - 489 WP_086321361 hypothetical protein -
FOA09_RS14175 (FOA09_15605) 52075..52860 - 786 WP_002360778 replication-relaxation family protein -
FOA09_RS14180 (FOA09_15610) 53383..55641 - 2259 WP_086321360 TraM recognition domain-containing protein virb4
FOA09_RS14185 (FOA09_15615) 55628..57973 - 2346 WP_010831073 hypothetical protein orf15
FOA09_RS14190 (FOA09_15620) 57991..58386 - 396 WP_002383639 hypothetical protein -
FOA09_RS14195 (FOA09_15625) 58343..60835 - 2493 WP_010773420 ATP-binding protein virb4
FOA09_RS14200 (FOA09_15630) 60940..61398 - 459 WP_002365911 single-stranded DNA-binding protein -
FOA09_RS14205 (FOA09_15635) 61491..61973 - 483 WP_002360790 hypothetical protein -
FOA09_RS14210 (FOA09_15640) 62005..62394 - 390 WP_002360791 TcpE family conjugal transfer membrane protein orf17b
FOA09_RS14215 (FOA09_15645) 62394..62654 - 261 WP_010706916 hypothetical protein -
FOA09_RS14220 (FOA09_15650) 62659..63693 - 1035 WP_002387763 conjugal transfer protein orf13
FOA09_RS14225 (FOA09_15655) 63686..64000 - 315 WP_002360796 hypothetical protein -
FOA09_RS14230 (FOA09_15660) 64000..64416 - 417 WP_002405608 thioredoxin domain-containing protein -
FOA09_RS14235 (FOA09_15665) 64400..65017 - 618 WP_002409352 hypothetical protein -
FOA09_RS14240 (FOA09_15670) 65020..66291 - 1272 WP_010711028 CHAP domain-containing protein trsG
FOA09_RS14245 (FOA09_15675) 66317..67174 - 858 WP_010717404 LPXTG cell wall anchor domain-containing protein prgC
FOA09_RS14250 (FOA09_15680) 67197..68075 - 879 WP_002365963 hypothetical protein -
FOA09_RS14255 (FOA09_15685) 68086..68346 - 261 WP_002370667 hypothetical protein -
FOA09_RS14265 (FOA09_15695) 68823..69176 - 354 WP_002379922 pheromone response system RNA-binding regulator PrgU -
FOA09_RS14270 (FOA09_15700) 69238..73128 - 3891 WP_010711026 LPXTG-anchored aggregation substance Asa1 prgB
FOA09_RS14275 (FOA09_15705) 73435..73770 - 336 WP_002360910 DUF5406 domain-containing protein -
FOA09_RS14280 (FOA09_15710) 74367..77039 - 2673 WP_002372553 surface exclusion protein SEA1/PrgA -
FOA09_RS14285 (FOA09_15715) 77050..77355 - 306 WP_002403278 hypothetical protein -

Host bacterium

ID   7410 GenBank   NZ_CP072508
Plasmid name   pL8 Incompatibility group   -
Plasmid size   91525 bp Coordinate of oriT [Strand]   8948..9127 [+]
Host baterium   Enterococcus faecalis strain L8

Cargo genes

Drug resistance gene   lnu(C), erm(B), erm(A), ant(9)-Ia, optrA
Virulence gene   asa1
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIIA9, AcrIIA21