Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 106728 |
| Name | oriT_pSal-5091_MCR64k  |
| Organism | Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP045521 (13729..13781 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_pSal-5091_MCR64k
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 4475 | GenBank | WP_015059539 |
| Name | t4cp2_GE195_RS23690_pSal-5091_MCR64k |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73404.02 Da Isoelectric Point: 9.4339
>WP_015059539.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MNAKKMGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LDQKAKGHNAPDVLVSISAILKTSIPDNGKDLAAWMGQEVENRSWISDKTKSFFFEFMSAPDRTRGSIKT
NFSSPLNIFSNPVTAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 35701..58543
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GE195_RS23625 (GE195_24090) | 30774..31306 | - | 533 | Protein_34 | thermonuclease family protein | - |
| GE195_RS23630 (GE195_24095) | 31336..31989 | - | 654 | WP_170855322 | hypothetical protein | - |
| GE195_RS23635 (GE195_24100) | 32001..33125 | - | 1125 | WP_000486716 | site-specific integrase | - |
| GE195_RS24285 (GE195_24105) | 33458..33676 | + | 219 | Protein_37 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| GE195_RS23640 (GE195_24110) | 33673..35049 | - | 1377 | WP_000750519 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| GE195_RS23645 (GE195_24115) | 35062..35697 | - | 636 | WP_000934977 | A24 family peptidase | - |
| GE195_RS23650 (GE195_24120) | 35701..36183 | - | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
| GE195_RS23655 (GE195_24125) | 36249..36812 | - | 564 | WP_034169414 | type 4 pilus major pilin | - |
| GE195_RS23660 (GE195_24130) | 36862..37971 | - | 1110 | WP_000974903 | type II secretion system F family protein | - |
| GE195_RS23665 (GE195_24135) | 37962..39500 | - | 1539 | WP_000466225 | ATPase, T2SS/T4P/T4SS family | virB11 |
| GE195_RS23670 (GE195_24140) | 39525..40019 | - | 495 | WP_000912553 | type IV pilus biogenesis protein PilP | - |
| GE195_RS23675 (GE195_24145) | 40003..41313 | - | 1311 | WP_001454111 | type 4b pilus protein PilO2 | - |
| GE195_RS23680 (GE195_24150) | 41364..43007 | - | 1644 | WP_001035592 | PilN family type IVB pilus formation outer membrane protein | - |
| GE195_RS23685 (GE195_24155) | 43000..43548 | - | 549 | WP_073056756 | sigma 54-interacting transcriptional regulator | virb4 |
| GE195_RS23690 (GE195_24160) | 43595..45553 | - | 1959 | WP_015059539 | type IV secretory system conjugative DNA transfer family protein | - |
| GE195_RS23695 (GE195_24165) | 45569..46624 | - | 1056 | WP_001542006 | P-type DNA transfer ATPase VirB11 | virB11 |
| GE195_RS23700 (GE195_24170) | 46643..47782 | - | 1140 | WP_034169415 | TrbI/VirB10 family protein | virB10 |
| GE195_RS23705 (GE195_24175) | 47772..48473 | - | 702 | WP_000274524 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| GE195_RS23710 (GE195_24180) | 48539..49273 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| GE195_RS23715 (GE195_24185) | 49273..49407 | - | 135 | WP_000701233 | hypothetical protein | - |
| GE195_RS23720 (GE195_24190) | 49439..51796 | - | 2358 | WP_000548950 | VirB4 family type IV secretion system protein | virb4 |
| GE195_RS23725 (GE195_24195) | 51802..52122 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| GE195_RS24175 | 52193..52483 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| GE195_RS23735 (GE195_24205) | 52483..53067 | - | 585 | WP_001177117 | lytic transglycosylase domain-containing protein | virB1 |
| GE195_RS23740 (GE195_24210) | 53088..53486 | - | 399 | WP_001153669 | hypothetical protein | - |
| GE195_RS23745 (GE195_24215) | 53605..54042 | - | 438 | WP_034169416 | type IV pilus biogenesis protein PilM | - |
| GE195_RS23750 (GE195_24220) | 54048..55283 | - | 1236 | WP_034169417 | toxin co-regulated pilus biosynthesis Q family protein | - |
| GE195_RS23755 (GE195_24225) | 55286..55585 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| GE195_RS23760 (GE195_24230) | 55633..56442 | + | 810 | WP_024237698 | DUF5710 domain-containing protein | - |
| GE195_RS23765 (GE195_24235) | 56665..56889 | - | 225 | WP_000713562 | EexN family lipoprotein | - |
| GE195_RS23770 (GE195_24240) | 56898..57542 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| GE195_RS23775 (GE195_24245) | 57548..58543 | - | 996 | WP_001028540 | type IV secretion system protein | virB6 |
| GE195_RS23780 (GE195_24250) | 58547..58804 | - | 258 | WP_000739144 | hypothetical protein | - |
| GE195_RS23785 (GE195_24255) | 58801..59103 | - | 303 | WP_001360345 | hypothetical protein | - |
| GE195_RS23790 (GE195_24260) | 59084..59341 | - | 258 | WP_001542015 | hypothetical protein | - |
| GE195_RS23795 (GE195_24265) | 59374..59820 | - | 447 | WP_001243165 | hypothetical protein | - |
| GE195_RS23800 | 59831..60001 | - | 171 | WP_000550720 | hypothetical protein | - |
| GE195_RS23805 (GE195_24270) | 60005..60448 | - | 444 | WP_000964330 | NfeD family protein | - |
| GE195_RS23810 (GE195_24280) | 60822..61775 | - | 954 | WP_072089442 | SPFH domain-containing protein | - |
| GE195_RS23815 | 61802..61978 | - | 177 | WP_000753050 | hypothetical protein | - |
| GE195_RS23820 (GE195_24285) | 61971..62186 | - | 216 | WP_001127357 | DUF1187 family protein | - |
| GE195_RS23825 (GE195_24290) | 62179..62631 | - | 453 | WP_000101552 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 7165 | GenBank | NZ_CP045521 |
| Plasmid name | pSal-5091_MCR64k | Incompatibility group | IncI2 |
| Plasmid size | 63762 bp | Coordinate of oriT [Strand] | 13729..13781 [-] |
| Host baterium | Salmonella enterica subsp. enterica serovar Anatum strain Sal-5091 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |