Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106722
Name   oriT_p55k in_silico
Organism   Salmonella enterica subsp. enterica serovar Anatum strain M-5360
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP045511 (31645..31750 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_p55k
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   4442 GenBank   WP_050868819
Name   Relaxase_GE194_RS23090_p55k insolico UniProt ID   A0A142BMF1
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75234.98 Da        Isoelectric Point: 10.0285

>WP_050868819.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPVYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSERDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A142BMF1


T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 34546..53649

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GE194_RS23070 (GE194_23410) 29630..29941 + 312 WP_011091065 hypothetical protein -
GE194_RS23075 (GE194_23415) 30074..30610 + 537 WP_011091066 hypothetical protein -
GE194_RS23080 (GE194_23420) 31111..31476 - 366 WP_011091067 hypothetical protein -
GE194_RS23785 31491..32069 + 579 WP_223811519 plasmid mobilization protein MobA -
GE194_RS23090 (GE194_23430) 32056..34035 + 1980 WP_050868819 TraI/MobA(P) family conjugative relaxase -
GE194_RS23095 (GE194_23435) 34049..34549 + 501 WP_004187320 DotD/TraH family lipoprotein -
GE194_RS23100 (GE194_23440) 34546..35325 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
GE194_RS23105 (GE194_23445) 35336..36499 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
GE194_RS23110 (GE194_23450) 36489..36749 + 261 WP_004187310 IcmT/TraK family protein traK
GE194_RS23790 36774..39986 + 3213 WP_011091070 LPD7 domain-containing protein -
GE194_RS23120 (GE194_23460) 39952..40464 + 513 WP_011091071 hypothetical protein traL
GE194_RS23125 (GE194_23465) 40465..40677 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
GE194_RS23130 (GE194_23470) 40649..41059 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
GE194_RS23135 (GE194_23475) 41127..41840 + 714 WP_109914255 DotI/IcmL family type IV secretion protein traM
GE194_RS23140 (GE194_23480) 41849..43000 + 1152 WP_011091074 DotH/IcmK family type IV secretion protein traN
GE194_RS23145 (GE194_23485) 43012..44361 + 1350 WP_011091075 conjugal transfer protein TraO traO
GE194_RS23150 (GE194_23490) 44373..45077 + 705 WP_011091076 conjugal transfer protein TraP traP
GE194_RS23155 (GE194_23495) 45101..45631 + 531 WP_011091077 conjugal transfer protein TraQ traQ
GE194_RS23160 (GE194_23500) 45648..46037 + 390 WP_011091078 DUF6750 family protein traR
GE194_RS23165 (GE194_23505) 46083..46577 + 495 WP_011091080 hypothetical protein -
GE194_RS23170 (GE194_23510) 46574..49624 + 3051 WP_011091081 hypothetical protein traU
GE194_RS23175 (GE194_23515) 49621..50829 + 1209 WP_011091082 conjugal transfer protein TraW traW
GE194_RS23180 (GE194_23520) 50826..51476 + 651 WP_011091083 hypothetical protein -
GE194_RS23185 (GE194_23525) 51469..53649 + 2181 WP_004187492 DotA/TraY family protein traY
GE194_RS23190 (GE194_23530) 53652..54305 + 654 WP_011091084 hypothetical protein -
GE194_RS23195 (GE194_23535) 54380..54610 + 231 WP_011091085 IncL/M type plasmid replication protein RepC -

Host bacterium

ID   7159 GenBank   NZ_CP045511
Plasmid name   p55k Incompatibility group   IncL/M
Plasmid size   54907 bp Coordinate of oriT [Strand]   31645..31750 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Anatum strain M-5360

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -