Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106652
Name   oriT_RHB44-C03|unnamed4 in_silico
Organism   Escherichia fergusonii strain RHB44-C03
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP099335 (13051..13103 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_RHB44-C03|unnamed4
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   4433 GenBank   WP_000338976
Name   t4cp2_NFK96_RS23400_RHB44-C03|unnamed4 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73346.95 Da        Isoelectric Point: 9.3476

>WP_000338976.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 32304..54706

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK96_RS23350 (NFK96_23305) 28695..28868 - 174 Protein_36 integrase -
NFK96_RS23855 29481..29702 + 222 Protein_37 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
NFK96_RS23355 (NFK96_23310) 30366..31652 - 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
NFK96_RS23360 (NFK96_23315) 31665..32300 - 636 WP_000934979 A24 family peptidase -
NFK96_RS23365 (NFK96_23320) 32304..32786 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
NFK96_RS23370 (NFK96_23325) 32852..33409 - 558 WP_000095048 type 4 pilus major pilin -
NFK96_RS23375 (NFK96_23330) 33454..34563 - 1110 WP_000974903 type II secretion system F family protein -
NFK96_RS23380 (NFK96_23335) 34554..36092 - 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
NFK96_RS23385 (NFK96_23340) 36117..36611 - 495 WP_000912553 type IV pilus biogenesis protein PilP -
NFK96_RS23390 (NFK96_23345) 36595..37905 - 1311 WP_001454111 type 4b pilus protein PilO2 -
NFK96_RS23395 (NFK96_23350) 37956..39599 - 1644 WP_279284744 PilN family type IVB pilus formation outer membrane protein -
NFK96_RS23400 (NFK96_23355) 39650..41608 - 1959 WP_000338976 type IV secretory system conjugative DNA transfer family protein -
NFK96_RS23405 (NFK96_23360) 41624..42679 - 1056 WP_279284745 P-type DNA transfer ATPase VirB11 virB11
NFK96_RS23410 (NFK96_23365) 42698..43837 - 1140 WP_000790638 TrbI/VirB10 family protein virB10
NFK96_RS23415 (NFK96_23370) 43827..44528 - 702 WP_341475546 TrbG/VirB9 family P-type conjugative transfer protein -
NFK96_RS23420 (NFK96_23375) 44594..45328 - 735 WP_000432283 type IV secretion system protein virB8
NFK96_RS23425 (NFK96_23380) 45328..45462 - 135 WP_095526288 traF protein -
NFK96_RS23430 (NFK96_23385) 45494..47851 - 2358 WP_135280266 VirB4 family type IV secretion system protein virb4
NFK96_RS23435 (NFK96_23390) 47857..48177 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
NFK96_RS23440 (NFK96_23395) 48248..48538 - 291 WP_000865478 TrbC/VirB2 family protein virB2
NFK96_RS23445 (NFK96_23400) 48538..49122 - 585 WP_001177118 lytic transglycosylase domain-containing protein virB1
NFK96_RS23450 (NFK96_23405) 49143..49541 - 399 WP_001153669 hypothetical protein -
NFK96_RS23455 (NFK96_23410) 49660..50097 - 438 WP_000539665 type IV pilus biogenesis protein PilM -
NFK96_RS23460 (NFK96_23415) 50103..51338 - 1236 WP_000733392 toxin co-regulated pilus biosynthesis Q family protein -
NFK96_RS23465 (NFK96_23420) 51341..51628 - 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
NFK96_RS23470 (NFK96_23425) 51800..52435 - 636 WP_279284747 hypothetical protein -
NFK96_RS23475 (NFK96_23430) 52508..52795 - 288 WP_001032611 EexN family lipoprotein -
NFK96_RS23480 (NFK96_23435) 52808..53062 - 255 WP_001043555 EexN family lipoprotein -
NFK96_RS23485 (NFK96_23440) 53064..53705 - 642 WP_001425343 type IV secretion system protein -
NFK96_RS23490 (NFK96_23445) 53711..54706 - 996 WP_001028543 type IV secretion system protein virB6
NFK96_RS23495 (NFK96_23450) 54710..54967 - 258 WP_000739144 hypothetical protein -
NFK96_RS23500 (NFK96_23455) 54964..55266 - 303 WP_001360345 hypothetical protein -
NFK96_RS23505 (NFK96_23460) 55247..55504 - 258 WP_001542015 hypothetical protein -
NFK96_RS23510 (NFK96_23465) 55537..55983 - 447 WP_001243165 hypothetical protein -
NFK96_RS23515 (NFK96_23470) 55994..56164 - 171 WP_000550720 hypothetical protein -
NFK96_RS23520 (NFK96_23475) 56168..56611 - 444 WP_000964330 NfeD family protein -
NFK96_RS23525 (NFK96_23480) 56985..57938 - 954 WP_072089442 SPFH domain-containing protein -
NFK96_RS23530 (NFK96_23485) 57965..58141 - 177 WP_000753049 hypothetical protein -
NFK96_RS23535 (NFK96_23490) 58134..58349 - 216 WP_001127357 DUF1187 family protein -
NFK96_RS23540 (NFK96_23495) 58342..58794 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -


Host bacterium


ID   7089 GenBank   NZ_CP099335
Plasmid name   RHB44-C03|unnamed4 Incompatibility group   IncI2
Plasmid size   59932 bp Coordinate of oriT [Strand]   13051..13103 [-]
Host baterium   Escherichia fergusonii strain RHB44-C03

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -