Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106649
Name   oriT_RHB35-E2-C08|unnamed2 in_silico
Organism   Escherichia marmotae strain RHB35-E2-C08
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP099346 (6357..6417 [-], 61 nt)
oriT length   61 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 61 nt

>oriT_RHB35-E2-C08|unnamed2
GGGTTTCGGAGCGCAGCCCTGAACCAGTTCACAGAGCGCTAGCGGAGTGTATACCGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   4431 GenBank   WP_279283667
Name   traC_NFK54_RS24515_RHB35-E2-C08|unnamed2 insolico UniProt ID   _
Length   879 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 879 a.a.        Molecular weight: 100388.22 Da        Isoelectric Point: 6.4549

>WP_279283667.1 type IV secretion system protein TraC [Escherichia marmotae]
MSRERQPEQQEVKGWQVLLSQLLGGWKTPDGSQQAQQILDEMDYPSFASLLPYRRYDPDSELFINARTAG
FILECAPLSGANEAISKSLDYFLRDKIPRKVPLTFMLVGSPCVRPMLERGLADFRWQGKRADEFNAITRA
YYERAALTKFANKKGYPLTLRHYRLFVSYAEEVSSLTEQKKTELNQVANRVVAGLASAGLWSTRVDKHGL
VSLVRELANFRHGNTEPPGGDVAEFEPLNTECIDRSLRLMLHPDRIEQSLQSQRGGERERTRILNFMLEK
NPEKPYALWQMGDNISNVTDPLCTISCPFVMTLALEVEEQAGTQREANRKFIQLDKKANSPFAKFVPSVK
KQAAEWGGLRESLSTNQDSLARFYFNVTLFCEDRDEVALETEMTVLNTFRRNGLSMYMPEFMQLRNYLSV
FPFMMPEGLWSDICRSNAIQRARASNVANILPVVADNQVCLQGLPIPSYRNQLSFLNLFDRNAGLDTDNN
NLSVTGTSGGGKSFLMQGIIRQVLDSGGRAWVFDMGDSYKGLCRNVGGVYLNALDLRFNPFANIKDITAS
AESIRNLLVVLANPSGTCDDTFMSLLLKAVHEVWLRKKNSARIDDIVLYMREALEQPEYRDTTTVRSRMD
EIIVGLEKYCSWGIYGDYFNSEKPSLDDNVRFSVLEMGELKDKPDLLAAVMFSMMIYVEQRMYLSDRQQH
KVCLIDEAWKLLSKDNKRAEDFIENGYRTARKYNGAYITITQGIEDFDGQKASGAAKAAWANSSFKIILR
QNRDAFRKYCLDNPDQFNRFEREVIEGFPAAREAHFSAFMLRYGGQVSFHRLLLDPISRVMFSSDGEDFD
YREAGLRAGKDIHDIIGELAWRKFPQEMETLTEWIKHNH

  Protein domains


Predicted by InterproScan.

(303-455)

(45-280)

(487-772)

  Protein structure



No available structure.



ID   4432 GenBank   WP_000099426
Name   traD_NFK54_RS24620_RHB35-E2-C08|unnamed2 insolico UniProt ID   _
Length   728 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 728 a.a.        Molecular weight: 83452.80 Da        Isoelectric Point: 5.0806

>WP_000099426.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Escherichia]
MSSTKHITQGGQVFSYMLNMFMQVNKRVSFWLIWFFVIFLPLFFWLRLPWETIRNGGLYWWLSLTARGEK
ALYRVPPVYDIPWNGQVLHATSEQILKDDYMVWAGNMFLQELYLALFWASVAVGVLAFLIFRFLRRLGEK
QAQDERIGGRELTDDVKAVAREMRRRGEASSICIDKLPLLLNSEVQYLMMYGTPGAGKSNTLNKLLKQIR
ARGDMAIIYDKGCSLIKKHFSEQDDVLLNALDRRCAYWDMFREFESIPDFDSAASTLIPMGTKEDPFWQS
SARTIFSAVAYRQKKNGIHSYNALLRTLLAIDLKALRDYLAGTEASNLVEEKVEKTAISIRSVLTNYVKA
LRYLQGIERTGRRPFTIREWMSTVNDPQITRHGWLWVTSNARQHESLKPLISMWLAQAANCLLGMGENQH
RRIWFIYDELPSLNKLPELPGVLAEARKFGGCFVLGFQAKAQMDYTYGKEFADAMLGLVNTRYFFRSPSS
TEAEWVQREIGQRRDKVFSEQYSYGADTVRDGVSFSKVEEDRYLVNYTDIQKLPNLHCYVTFPGEYPAVR
MRMSYEKIKDCAEELLLRDINDSLDPEIESEITRREDEDGDIAALLDRIAQGDVRKDDEQNKTASQAGQA
ESLNNPVLAAAVTQGTAAAMTGGTGESNPVEEKAPVAELTEIVDKETGEILYPDDERYDELCRDSGQAQE
AMRQDECNLVSHQTNEAREQDDDREVNW

  Protein domains


Predicted by InterproScan.

(172-563)

(31-131)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 35566..63187

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NFK54_RS24410 (NFK54_24315) 31333..31482 + 150 Protein_39 plasmid maintenance protein Mok -
NFK54_RS24415 (NFK54_24320) 31424..31549 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
NFK54_RS24420 (NFK54_24325) 31850..32146 - 297 Protein_41 hypothetical protein -
NFK54_RS24425 (NFK54_24330) 32216..32422 + 207 WP_127766627 single-stranded DNA-binding protein -
NFK54_RS24430 (NFK54_24335) 32446..32742 + 297 WP_032083169 hypothetical protein -
NFK54_RS24435 (NFK54_24340) 32901..33143 + 243 WP_000540591 hypothetical protein -
NFK54_RS24440 (NFK54_24345) 33140..33259 + 120 Protein_45 class I SAM-dependent methyltransferase -
NFK54_RS24445 (NFK54_24350) 33348..33764 - 417 Protein_46 hypothetical protein -
NFK54_RS24450 (NFK54_24355) 33834..34040 + 207 WP_279283664 single-stranded DNA-binding protein -
NFK54_RS24455 (NFK54_24360) 34063..34359 + 297 WP_001272240 hypothetical protein -
NFK54_RS24460 (NFK54_24365) 34466..35287 + 822 WP_001234451 DUF932 domain-containing protein -
NFK54_RS24465 (NFK54_24370) 35566..36018 - 453 WP_024212709 transglycosylase SLT domain-containing protein virB1
NFK54_RS24470 (NFK54_24375) 36531..36926 + 396 WP_001137965 conjugal transfer relaxosome DNA-binding protein TraM -
NFK54_RS24475 (NFK54_24380) 37088..37816 + 729 WP_135403573 hypothetical protein -
NFK54_RS24480 (NFK54_24385) 37901..38107 + 207 WP_135403572 TraY domain-containing protein -
NFK54_RS24485 (NFK54_24390) 38409..38792 + 384 WP_279283665 type IV conjugative transfer system pilin TraA -
NFK54_RS24490 (NFK54_24395) 38823..39122 + 300 WP_001204091 type IV conjugative transfer system protein TraL traL
NFK54_RS24495 (NFK54_24400) 39133..39711 + 579 WP_000365869 type IV conjugative transfer system protein TraE traE
NFK54_RS24500 (NFK54_24405) 39686..40465 + 780 WP_279283666 type-F conjugative transfer system secretin TraK traK
NFK54_RS24505 (NFK54_24410) 40458..41792 + 1335 WP_053272771 F-type conjugal transfer pilus assembly protein TraB traB
NFK54_RS24510 (NFK54_24415) 41804..42316 + 513 WP_001558300 type IV conjugative transfer system lipoprotein TraV traV
NFK54_RS24515 (NFK54_24420) 42313..44952 + 2640 WP_279283667 type IV secretion system protein TraC virb4
NFK54_RS24520 (NFK54_24425) 44931..45347 + 417 WP_279283668 type-F conjugative transfer system protein TrbI -
NFK54_RS24525 (NFK54_24430) 45350..45574 + 225 WP_000752802 TraR/DksA C4-type zinc finger protein -
NFK54_RS24530 (NFK54_24435) 45571..46188 + 618 WP_167780306 type-F conjugative transfer system protein TraW traW
NFK54_RS24535 (NFK54_24440) 46185..46580 + 396 WP_151567967 hypothetical protein -
NFK54_RS24540 (NFK54_24445) 46577..47575 + 999 WP_001558295 conjugal transfer pilus assembly protein TraU traU
NFK54_RS24545 (NFK54_24450) 47584..48069 + 486 WP_000216829 hypothetical protein -
NFK54_RS24550 (NFK54_24455) 48251..48499 + 249 Protein_67 conjugal transfer protein TraP -
NFK54_RS24555 (NFK54_24460) 48486..48803 + 318 Protein_68 conjugal transfer protein TrbD -
NFK54_RS24560 (NFK54_24465) 48971..49576 + 606 WP_250130495 type-F conjugative transfer system pilin assembly protein TrbC trbC
NFK54_RS24565 (NFK54_24470) 49573..51507 + 1935 WP_279283669 type-F conjugative transfer system mating-pair stabilization protein TraN traN
NFK54_RS24570 (NFK54_24475) 51509..52294 + 786 WP_001247978 type-F conjugative transfer system pilin assembly protein TraF traF
NFK54_RS24575 (NFK54_24480) 52312..52584 + 273 WP_001558287 hypothetical protein -
NFK54_RS24580 (NFK54_24485) 52586..53161 + 576 WP_000265824 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
NFK54_RS24585 (NFK54_24490) 53158..53547 + 390 WP_001202475 hypothetical protein -
NFK54_RS24590 (NFK54_24495) 53613..55019 + 1407 WP_001558285 conjugal transfer pilus assembly protein TraH traH
NFK54_RS24595 (NFK54_24500) 55019..57895 + 2877 WP_279283693 conjugal transfer mating-pair stabilization protein TraG traG
NFK54_RS24600 (NFK54_24505) 57910..58821 + 912 WP_001558283 hypothetical protein -
NFK54_RS24605 (NFK54_24510) 58893..59630 + 738 WP_000926075 conjugal transfer complement resistance protein TraT -
NFK54_RS24610 (NFK54_24515) 59758..60450 + 693 WP_000235175 hypothetical protein -
NFK54_RS24615 (NFK54_24520) 60592..60960 + 369 WP_237708211 DUF2726 domain-containing protein -
NFK54_RS24620 (NFK54_24525) 61001..63187 + 2187 WP_000099426 type IV conjugative transfer system coupling protein TraD virb4


Host bacterium


ID   7086 GenBank   NZ_CP099346
Plasmid name   RHB35-E2-C08|unnamed2 Incompatibility group   IncFII
Plasmid size   72595 bp Coordinate of oriT [Strand]   6357..6417 [-]
Host baterium   Escherichia marmotae strain RHB35-E2-C08

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -