Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106603
Name   oriT_p514780 in_silico
Organism   Salmonella enterica strain CRIN514780
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP119987 (233444..233532 [+], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p514780
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   4383 GenBank   WP_006855641
Name   nikB_P2V97_RS24050_p514780 insolico UniProt ID   A0A620WL05
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104006.42 Da        Isoelectric Point: 7.3526

>WP_006855641.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A620WL05


Auxiliary protein


ID   1950 GenBank   WP_001283947
Name   WP_001283947_p514780 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 189184..228066

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2V97_RS23820 (P2V97_23820) 184246..185313 + 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -
P2V97_RS23825 (P2V97_23825) 185313..185750 + 438 WP_000539807 type IV pilus biogenesis protein PilM -
P2V97_RS23830 (P2V97_23830) 185764..187446 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
P2V97_RS23835 (P2V97_23835) 187439..188734 + 1296 WP_058649964 type 4b pilus protein PilO2 -
P2V97_RS23840 (P2V97_23840) 188721..189173 + 453 WP_058649963 type IV pilus biogenesis protein PilP -
P2V97_RS23845 (P2V97_23845) 189184..190737 + 1554 WP_000362204 ATPase, T2SS/T4P/T4SS family virB11
P2V97_RS23850 (P2V97_23850) 190750..191835 + 1086 WP_001208803 type II secretion system F family protein -
P2V97_RS23855 (P2V97_23855) 191852..192466 + 615 WP_000908228 type 4 pilus major pilin -
P2V97_RS23860 (P2V97_23860) 192476..193036 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
P2V97_RS23865 (P2V97_23865) 193021..193677 + 657 WP_001193551 A24 family peptidase -
P2V97_RS23870 (P2V97_23870) 193677..194969 + 1293 WP_039719938 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
P2V97_RS23875 (P2V97_23875) 194966..195214 - 249 WP_001349157 hypothetical protein -
P2V97_RS23880 (P2V97_23880) 195897..197051 + 1155 WP_001139955 site-specific integrase -
P2V97_RS23885 (P2V97_23885) 197202..198026 + 825 WP_058649947 conjugal transfer protein TraE traE
P2V97_RS23890 (P2V97_23890) 198112..199314 + 1203 WP_000976353 conjugal transfer protein TraF -
P2V97_RS23895 (P2V97_23895) 199374..199958 + 585 WP_000977520 histidine phosphatase family protein -
P2V97_RS23900 (P2V97_23900) 200353..200811 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
P2V97_RS23905 (P2V97_23905) 200808..201626 + 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
P2V97_RS23910 (P2V97_23910) 201623..202771 + 1149 WP_001024976 plasmid transfer ATPase TraJ virB11
P2V97_RS23915 (P2V97_23915) 202768..203058 + 291 WP_001299214 hypothetical protein traK
P2V97_RS23920 (P2V97_23920) 203073..203624 + 552 WP_000014584 phospholipase D family protein -
P2V97_RS23925 (P2V97_23925) 203714..207481 + 3768 WP_058649948 LPD7 domain-containing protein -
P2V97_RS23930 (P2V97_23930) 207499..207846 + 348 WP_001055900 conjugal transfer protein traL
P2V97_RS23935 (P2V97_23935) 207843..208535 + 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
P2V97_RS23940 (P2V97_23940) 208546..209529 + 984 WP_021513963 IncI1-type conjugal transfer protein TraN traN
P2V97_RS23945 (P2V97_23945) 209532..210821 + 1290 WP_001271994 conjugal transfer protein TraO traO
P2V97_RS23950 (P2V97_23950) 210821..211525 + 705 WP_023155244 IncI1-type conjugal transfer protein TraP traP
P2V97_RS23955 (P2V97_23955) 211525..212052 + 528 WP_001055569 conjugal transfer protein TraQ traQ
P2V97_RS23960 (P2V97_23960) 212103..212507 + 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
P2V97_RS23965 (P2V97_23965) 212571..212759 + 189 WP_001277255 putative conjugal transfer protein TraS -
P2V97_RS23970 (P2V97_23970) 212743..213543 + 801 WP_001164792 IncI1-type conjugal transfer protein TraT traT
P2V97_RS23975 (P2V97_23975) 213633..216677 + 3045 WP_001024776 IncI1-type conjugal transfer protein TraU traU
P2V97_RS23980 (P2V97_23980) 216677..217291 + 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
P2V97_RS23985 (P2V97_23985) 217258..218460 + 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
P2V97_RS23990 (P2V97_23990) 218489..219073 + 585 WP_001037996 IncI1-type conjugal transfer protein TraX -
P2V97_RS23995 (P2V97_23995) 219170..221338 + 2169 WP_058649949 DotA/TraY family protein traY
P2V97_RS24000 (P2V97_24000) 221409..222071 + 663 WP_000644796 plasmid IncI1-type surface exclusion protein ExcA -
P2V97_RS24005 (P2V97_24005) 222143..222352 - 210 WP_000062603 HEAT repeat domain-containing protein -
P2V97_RS24010 (P2V97_24010) 222744..222920 + 177 WP_001054897 hypothetical protein -
P2V97_RS24015 (P2V97_24015) 222985..223080 - 96 WP_000609148 DinQ-like type I toxin DqlB -
P2V97_RS24020 (P2V97_24020) 223581..223832 + 252 WP_001291964 hypothetical protein -
P2V97_RS24025 (P2V97_24025) 223904..224056 - 153 WP_001387489 Hok/Gef family protein -
P2V97_RS24030 (P2V97_24030) 224683..225462 + 780 WP_275450201 protein FinQ -
P2V97_RS24035 (P2V97_24035) 225769..226977 + 1209 WP_001383960 IncI1-type conjugal transfer protein TrbA trbA
P2V97_RS24040 (P2V97_24040) 226996..228066 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
P2V97_RS24045 (P2V97_24045) 228059..230350 + 2292 Protein_216 F-type conjugative transfer protein TrbC -


Host bacterium


ID   7040 GenBank   NZ_CP119987
Plasmid name   p514780 Incompatibility group   IncFIB
Plasmid size   312164 bp Coordinate of oriT [Strand]   233444..233532 [+]
Host baterium   Salmonella enterica strain CRIN514780

Cargo genes


Drug resistance gene   ant(3'')-Ia, qacE, sul1, tet(A), blaCTX-M-65, floR, aph(4)-Ia, aac(3)-IVa, aph(3')-Ia
Virulence gene   faeC, faeE, faeF, faeH, faeI, fyuA, ybtE, ybtT, ybtU, irp1, irp2, ybtA, ybtP, ybtQ, ybtX, ybtS
Metal resistance gene   merE, merD, merA, merP, merT, merR, arsH, arsA
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2