Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106600
Name   oriT_p525628 in_silico
Organism   Salmonella enterica strain CRIN525628
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP119981 (233451..233539 [+], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p525628
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGCAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTGCACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   4381 GenBank   WP_006855641
Name   nikB_P2V98_RS24045_p525628 insolico UniProt ID   A0A620WL05
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 104006.42 Da        Isoelectric Point: 7.3526

>WP_006855641.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELDLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIARQAHYAKDDTDPVFHYILSWQSHESPRPEQIYDSVR
HTLKSLGLADHQYVSAVHTDTDNLHVHVAVNRVHPETGYLNRLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVHDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDKSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A620WL05


Auxiliary protein


ID   1948 GenBank   WP_001283947
Name   WP_001283947_p525628 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 189184..228073

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P2V98_RS23820 (P2V98_23820) 184246..185313 + 1068 WP_001360287 type IV pilus biogenesis lipoprotein PilL -
P2V98_RS23825 (P2V98_23825) 185313..185750 + 438 WP_000539807 type IV pilus biogenesis protein PilM -
P2V98_RS23830 (P2V98_23830) 185764..187446 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
P2V98_RS23835 (P2V98_23835) 187439..188734 + 1296 WP_058649964 type 4b pilus protein PilO2 -
P2V98_RS23840 (P2V98_23840) 188721..189173 + 453 WP_058649963 type IV pilus biogenesis protein PilP -
P2V98_RS23845 (P2V98_23845) 189184..190737 + 1554 WP_000362204 ATPase, T2SS/T4P/T4SS family virB11
P2V98_RS23850 (P2V98_23850) 190750..191835 + 1086 WP_001208803 type II secretion system F family protein -
P2V98_RS23855 (P2V98_23855) 191852..192466 + 615 WP_000908228 type 4 pilus major pilin -
P2V98_RS23860 (P2V98_23860) 192476..193036 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
P2V98_RS23865 (P2V98_23865) 193021..193677 + 657 WP_001193551 A24 family peptidase -
P2V98_RS23870 (P2V98_23870) 193665..195101 + 1437 WP_015058913 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
P2V98_RS24465 195098..195322 - 225 Protein_182 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
P2V98_RS23875 (P2V98_23875) 195904..197058 + 1155 WP_001139955 site-specific integrase -
P2V98_RS23880 (P2V98_23880) 197209..198033 + 825 WP_058649947 conjugal transfer protein TraE traE
P2V98_RS23885 (P2V98_23885) 198119..199321 + 1203 WP_000976353 conjugal transfer protein TraF -
P2V98_RS23890 (P2V98_23890) 199381..199965 + 585 WP_000977520 histidine phosphatase family protein -
P2V98_RS23895 (P2V98_23895) 200360..200818 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
P2V98_RS23900 (P2V98_23900) 200815..201633 + 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
P2V98_RS23905 (P2V98_23905) 201630..202778 + 1149 WP_001024976 plasmid transfer ATPase TraJ virB11
P2V98_RS23910 (P2V98_23910) 202775..203065 + 291 WP_001299214 hypothetical protein traK
P2V98_RS23915 (P2V98_23915) 203080..203631 + 552 WP_000014584 phospholipase D family protein -
P2V98_RS23920 (P2V98_23920) 203721..207488 + 3768 WP_058649948 LPD7 domain-containing protein -
P2V98_RS23925 (P2V98_23925) 207506..207853 + 348 WP_001055900 conjugal transfer protein traL
P2V98_RS23930 (P2V98_23930) 207850..208542 + 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
P2V98_RS23935 (P2V98_23935) 208553..209536 + 984 WP_021513963 IncI1-type conjugal transfer protein TraN traN
P2V98_RS23940 (P2V98_23940) 209539..210828 + 1290 WP_001271994 conjugal transfer protein TraO traO
P2V98_RS23945 (P2V98_23945) 210828..211532 + 705 WP_023155244 IncI1-type conjugal transfer protein TraP traP
P2V98_RS23950 (P2V98_23950) 211532..212059 + 528 WP_001055569 conjugal transfer protein TraQ traQ
P2V98_RS23955 (P2V98_23955) 212110..212514 + 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
P2V98_RS23960 (P2V98_23960) 212578..212766 + 189 WP_001277255 putative conjugal transfer protein TraS -
P2V98_RS23965 (P2V98_23965) 212750..213550 + 801 WP_001164792 IncI1-type conjugal transfer protein TraT traT
P2V98_RS23970 (P2V98_23970) 213640..216684 + 3045 WP_001024776 IncI1-type conjugal transfer protein TraU traU
P2V98_RS23975 (P2V98_23975) 216684..217298 + 615 WP_000337399 IncI1-type conjugal transfer protein TraV traV
P2V98_RS23980 (P2V98_23980) 217265..218467 + 1203 WP_001189156 IncI1-type conjugal transfer protein TraW traW
P2V98_RS23985 (P2V98_23985) 218496..219080 + 585 WP_001037996 IncI1-type conjugal transfer protein TraX -
P2V98_RS23990 (P2V98_23990) 219177..221345 + 2169 WP_058649949 DotA/TraY family protein traY
P2V98_RS23995 (P2V98_23995) 221416..222078 + 663 WP_000644796 plasmid IncI1-type surface exclusion protein ExcA -
P2V98_RS24000 (P2V98_24000) 222150..222359 - 210 WP_000062603 HEAT repeat domain-containing protein -
P2V98_RS24005 (P2V98_24005) 222751..222927 + 177 WP_001054897 hypothetical protein -
P2V98_RS24010 (P2V98_24010) 222992..223087 - 96 WP_000609148 DinQ-like type I toxin DqlB -
P2V98_RS24015 (P2V98_24015) 223588..223839 + 252 WP_001291964 hypothetical protein -
P2V98_RS24020 (P2V98_24020) 223911..224063 - 153 WP_001387489 Hok/Gef family protein -
P2V98_RS24025 (P2V98_24025) 224690..225469 + 780 WP_275450201 protein FinQ -
P2V98_RS24030 (P2V98_24030) 225776..226984 + 1209 WP_001383960 IncI1-type conjugal transfer protein TrbA trbA
P2V98_RS24035 (P2V98_24035) 227003..228073 + 1071 WP_000151583 IncI1-type conjugal transfer protein TrbB trbB
P2V98_RS24040 (P2V98_24040) 228066..230357 + 2292 Protein_216 F-type conjugative transfer protein TrbC -


Host bacterium


ID   7037 GenBank   NZ_CP119981
Plasmid name   p525628 Incompatibility group   IncFIB
Plasmid size   294021 bp Coordinate of oriT [Strand]   233451..233539 [+]
Host baterium   Salmonella enterica strain CRIN525628

Cargo genes


Drug resistance gene   ant(3'')-Ia, qacE, sul1, tet(A), blaCTX-M-65
Virulence gene   faeC, faeE, faeF, faeH, faeI, fyuA, ybtE, ybtT, ybtU, irp1, irp2, ybtA, ybtP, ybtQ, ybtX, ybtS
Metal resistance gene   merE, merD, merA, merP, merT, merR, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2