Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 106466 |
| Name | oriT_p3045-3  |
| Organism | Raoultella planticola strain RP_3045 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP114775 (11101..11150 [+], 50 nt) |
| oriT length | 50 nt |
| IRs (inverted repeats) | 7..13, 18..24 (GCAAAAT..ATTTTGC) |
| Location of nic site | 33..34 |
| Conserved sequence flanking the nic site |
GGTGTGGTGA |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 50 nt
>oriT_p3045-3
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AAATCTGCAAAATATTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 4339 | GenBank | WP_032736842 |
| Name | traD_O4J57_RS30235_p3045-3 |
UniProt ID | _ |
| Length | 764 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 764 a.a. Molecular weight: 85398.61 Da Isoelectric Point: 5.0675
>WP_032736842.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDKPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLAPMR
DIIRSQPVYTISYYGKSLEYNAEQILADKYTIWCGEQLWTAFVFAAIVSLTICVVTFFVASWVLGRQGKL
QSEDENTGGRQLSDKPKDVARQMKRDGAASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMRGDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDQPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYNPRPKIAEGFIQRRLDTRIDERLSAQLEAREAEGSLVRALFTPDEPVSEPAEEKAGVQPEQTKPAKDS
VLPVPVKTSSMAAEGAGKTPAVPLSGAPVTRVKTVPLIRPKPAASVTGTAAAASTAAVSATAGGTEQELA
QQPVEADQDMLPAGMNEDGVIEDMQAYDAWLEGEQIQRDMQRREEVNINHSRSEQDDIEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 574..11703
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4J57_RS29725 (O4J57_29720) | 185..574 | - | 390 | WP_032736860 | type-F conjugative transfer system protein TrbI | - |
| O4J57_RS29730 (O4J57_29725) | 574..3213 | - | 2640 | WP_032736861 | type IV secretion system protein TraC | virb4 |
| O4J57_RS29735 (O4J57_29730) | 3306..3689 | - | 384 | WP_278078927 | hypothetical protein | - |
| O4J57_RS29740 (O4J57_29735) | 3777..4076 | - | 300 | WP_032736863 | hypothetical protein | - |
| O4J57_RS29745 (O4J57_29740) | 4073..4474 | - | 402 | WP_032736864 | hypothetical protein | - |
| O4J57_RS29750 (O4J57_29745) | 4559..4837 | - | 279 | WP_278078930 | hypothetical protein | - |
| O4J57_RS29755 (O4J57_29750) | 4949..5518 | - | 570 | WP_042946293 | type IV conjugative transfer system lipoprotein TraV | traV |
| O4J57_RS29760 (O4J57_29755) | 5538..5699 | - | 162 | WP_154235504 | hypothetical protein | - |
| O4J57_RS29765 (O4J57_29760) | 5692..7113 | - | 1422 | WP_032736866 | F-type conjugal transfer pilus assembly protein TraB | traB |
| O4J57_RS29770 (O4J57_29765) | 7113..7847 | - | 735 | WP_032736867 | type-F conjugative transfer system secretin TraK | traK |
| O4J57_RS29775 (O4J57_29770) | 7834..8400 | - | 567 | WP_032736869 | type IV conjugative transfer system protein TraE | traE |
| O4J57_RS29780 (O4J57_29775) | 8420..8725 | - | 306 | WP_032736870 | type IV conjugative transfer system protein TraL | traL |
| O4J57_RS29785 (O4J57_29780) | 8739..9107 | - | 369 | WP_032736871 | type IV conjugative transfer system pilin TraA | - |
| O4J57_RS29790 (O4J57_29785) | 9176..9376 | - | 201 | WP_060415469 | TraY domain-containing protein | - |
| O4J57_RS29795 (O4J57_29790) | 9461..10162 | - | 702 | WP_032736872 | hypothetical protein | - |
| O4J57_RS29800 (O4J57_29795) | 10401..10793 | - | 393 | WP_032736874 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| O4J57_RS29805 (O4J57_29800) | 11224..11703 | + | 480 | WP_032716648 | transglycosylase SLT domain-containing protein | virB1 |
| O4J57_RS29810 (O4J57_29805) | 11741..12271 | - | 531 | WP_032716647 | antirestriction protein | - |
| O4J57_RS29815 (O4J57_29810) | 12956..13102 | - | 147 | WP_032700834 | hypothetical protein | - |
| O4J57_RS29820 (O4J57_29815) | 13196..13543 | - | 348 | WP_032700835 | hypothetical protein | - |
| O4J57_RS29825 (O4J57_29820) | 13569..13727 | - | 159 | WP_162180130 | hypothetical protein | - |
| O4J57_RS29830 (O4J57_29825) | 13784..14059 | - | 276 | WP_032700867 | hypothetical protein | - |
| O4J57_RS29835 (O4J57_29830) | 14878..15159 | - | 282 | WP_004118961 | helix-turn-helix transcriptional regulator | - |
| O4J57_RS29840 (O4J57_29835) | 15140..15469 | - | 330 | WP_004118963 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| O4J57_RS29845 (O4J57_29840) | 15789..15876 | - | 88 | Protein_25 | theronine dehydrogenase | - |
| O4J57_RS29850 (O4J57_29845) | 15873..16601 | - | 729 | WP_004118966 | plasmid SOS inhibition protein A | - |
Region 2: 98822..112675
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4J57_RS30235 (O4J57_30230) | 98822..101116 | - | 2295 | WP_032736842 | type IV conjugative transfer system coupling protein TraD | virb4 |
| O4J57_RS30240 (O4J57_30235) | 101323..101850 | - | 528 | WP_032736843 | hypothetical protein | - |
| O4J57_RS30245 (O4J57_30240) | 101861..104704 | - | 2844 | WP_032736845 | conjugal transfer mating-pair stabilization protein TraG | traG |
| O4J57_RS30250 (O4J57_30245) | 104704..106074 | - | 1371 | WP_032736846 | conjugal transfer pilus assembly protein TraH | traH |
| O4J57_RS30255 (O4J57_30250) | 106061..106624 | - | 564 | WP_224250969 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
| O4J57_RS30260 (O4J57_30255) | 106611..106847 | - | 237 | WP_032736848 | type-F conjugative transfer system pilin chaperone TraQ | - |
| O4J57_RS30265 (O4J57_30260) | 106858..107610 | - | 753 | WP_032736849 | type-F conjugative transfer system pilin assembly protein TraF | traF |
| O4J57_RS30270 (O4J57_30265) | 107631..107957 | - | 327 | WP_032736851 | hypothetical protein | - |
| O4J57_RS30275 (O4J57_30270) | 108004..108189 | - | 186 | WP_032736852 | hypothetical protein | - |
| O4J57_RS30280 (O4J57_30275) | 108186..108422 | - | 237 | WP_032736854 | conjugal transfer protein TrbE | - |
| O4J57_RS30285 (O4J57_30280) | 108412..109023 | - | 612 | WP_032736855 | hypothetical protein | - |
| O4J57_RS30290 (O4J57_30285) | 109137..111080 | - | 1944 | WP_032736856 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
| O4J57_RS30295 (O4J57_30290) | 111077..111703 | - | 627 | WP_032736857 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
| O4J57_RS30300 (O4J57_30295) | 111716..112675 | - | 960 | WP_088912317 | conjugal transfer pilus assembly protein TraU | traU |
Host bacterium
| ID | 6903 | GenBank | NZ_CP114775 |
| Plasmid name | p3045-3 | Incompatibility group | IncFII |
| Plasmid size | 113157 bp | Coordinate of oriT [Strand] | 11101..11150 [+] |
| Host baterium | Raoultella planticola strain RP_3045 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |