Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 106274 |
Name | oriT_pKP106-2 |
Organism | Klebsiella pneumoniae strain KP106 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP089876 (91600..91648 [-], 49 nt) |
oriT length | 49 nt |
IRs (inverted repeats) | 6..13, 16..23 (GCAAAATT..AATTTTGC) |
Location of nic site | 32..33 |
Conserved sequence flanking the nic site |
GGTGTGGTGA |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 49 nt
>oriT_pKP106-2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 4225 | GenBank | WP_013023832 |
Name | traD_LVQ73_RS26345_pKP106-2 | UniProt ID | _ |
Length | 770 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 770 a.a. Molecular weight: 85974.10 Da Isoelectric Point: 5.1149
>WP_013023832.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 91042..110393
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LVQ73_RS26845 (LVQ73_26820) | 86144..86356 | + | 213 | WP_013023815 | hypothetical protein | - |
LVQ73_RS26850 (LVQ73_26825) | 86367..86591 | + | 225 | WP_004152719 | hypothetical protein | - |
LVQ73_RS26855 (LVQ73_26830) | 86672..86992 | + | 321 | WP_004152720 | type II toxin-antitoxin system RelE/ParE family toxin | - |
LVQ73_RS26860 (LVQ73_26835) | 86982..87260 | + | 279 | WP_004152721 | helix-turn-helix transcriptional regulator | - |
LVQ73_RS26865 (LVQ73_26840) | 87261..87674 | + | 414 | WP_013023817 | helix-turn-helix domain-containing protein | - |
LVQ73_RS26870 (LVQ73_26845) | 87810..89018 | - | 1209 | WP_015344990 | IS256 family transposase | - |
LVQ73_RS26875 (LVQ73_26850) | 89826..90647 | + | 822 | WP_004152492 | DUF932 domain-containing protein | - |
LVQ73_RS26880 (LVQ73_26855) | 90680..91009 | + | 330 | WP_011977736 | DUF5983 family protein | - |
LVQ73_RS26885 (LVQ73_26860) | 91042..91527 | - | 486 | WP_001568108 | transglycosylase SLT domain-containing protein | virB1 |
LVQ73_RS26890 (LVQ73_26865) | 91959..92351 | + | 393 | WP_004194114 | conjugal transfer relaxosome DNA-binding protein TraM | - |
LVQ73_RS26895 (LVQ73_26870) | 92581..93282 | + | 702 | WP_004194113 | hypothetical protein | - |
LVQ73_RS26900 (LVQ73_26875) | 93368..93568 | + | 201 | WP_004194116 | TraY domain-containing protein | - |
LVQ73_RS26905 (LVQ73_26880) | 93637..94005 | + | 369 | WP_004194426 | type IV conjugative transfer system pilin TraA | - |
LVQ73_RS26910 (LVQ73_26885) | 94019..94324 | + | 306 | WP_004144424 | type IV conjugative transfer system protein TraL | traL |
LVQ73_RS26915 (LVQ73_26890) | 94344..94910 | + | 567 | WP_004144423 | type IV conjugative transfer system protein TraE | traE |
LVQ73_RS26920 (LVQ73_26895) | 94897..95637 | + | 741 | WP_013023821 | type-F conjugative transfer system secretin TraK | traK |
LVQ73_RS26925 (LVQ73_26900) | 95637..97061 | + | 1425 | WP_004194260 | F-type conjugal transfer pilus assembly protein TraB | traB |
LVQ73_RS26930 (LVQ73_26905) | 97175..97759 | + | 585 | WP_013023822 | type IV conjugative transfer system lipoprotein TraV | traV |
LVQ73_RS26935 (LVQ73_26910) | 97891..98301 | + | 411 | WP_009309869 | hypothetical protein | - |
LVQ73_RS26940 (LVQ73_26915) | 98407..98625 | + | 219 | WP_015344987 | hypothetical protein | - |
LVQ73_RS26945 (LVQ73_26920) | 98626..98937 | + | 312 | WP_015344986 | hypothetical protein | - |
LVQ73_RS26950 (LVQ73_26925) | 99004..99408 | + | 405 | WP_004197817 | hypothetical protein | - |
LVQ73_RS26955 (LVQ73_26930) | 99784..100182 | + | 399 | WP_013609531 | hypothetical protein | - |
LVQ73_RS26960 (LVQ73_26935) | 100254..102893 | + | 2640 | WP_013023824 | type IV secretion system protein TraC | virb4 |
LVQ73_RS26965 (LVQ73_26940) | 102893..103282 | + | 390 | WP_004197815 | type-F conjugative transfer system protein TrbI | - |
LVQ73_RS26970 (LVQ73_26945) | 103282..103908 | + | 627 | WP_009309871 | type-F conjugative transfer system protein TraW | traW |
LVQ73_RS26975 (LVQ73_26950) | 103950..104339 | + | 390 | WP_004194992 | hypothetical protein | - |
LVQ73_RS26980 (LVQ73_26955) | 104336..105325 | + | 990 | WP_009309872 | conjugal transfer pilus assembly protein TraU | traU |
LVQ73_RS26985 (LVQ73_26960) | 105338..105976 | + | 639 | WP_011977786 | type-F conjugative transfer system pilin assembly protein TrbC | trbC |
LVQ73_RS26990 (LVQ73_26965) | 106035..107990 | + | 1956 | WP_013023827 | type-F conjugative transfer system mating-pair stabilization protein TraN | traN |
LVQ73_RS26995 (LVQ73_26970) | 108022..108276 | + | 255 | WP_004152674 | conjugal transfer protein TrbE | - |
LVQ73_RS27000 (LVQ73_26975) | 108254..108502 | + | 249 | WP_004152675 | hypothetical protein | - |
LVQ73_RS27005 (LVQ73_26980) | 108515..108841 | + | 327 | WP_004152676 | hypothetical protein | - |
LVQ73_RS27010 (LVQ73_26985) | 108862..109614 | + | 753 | WP_048337413 | type-F conjugative transfer system pilin assembly protein TraF | traF |
LVQ73_RS27015 (LVQ73_26990) | 109625..109864 | + | 240 | WP_004144400 | type-F conjugative transfer system pilin chaperone TraQ | - |
LVQ73_RS27020 (LVQ73_26995) | 109836..110393 | + | 558 | WP_013214031 | type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | traF |
Host bacterium
ID | 6711 | GenBank | NZ_CP089876 |
Plasmid name | pKP106-2 | Incompatibility group | IncFII |
Plasmid size | 110438 bp | Coordinate of oriT [Strand] | 91600..91648 [-] |
Host baterium | Klebsiella pneumoniae strain KP106 |
Cargo genes
Drug resistance gene | blaCTX-M-3, blaTEM-1B, aac(3)-IId, aph(3')-Ia, aph(6)-Id, aph(3'')-Ib, sul2 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | AcrIE9 |