Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106274
Name   oriT_pKP106-2 in_silico
Organism   Klebsiella pneumoniae strain KP106
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP089876 (91600..91648 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pKP106-2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   4225 GenBank   WP_013023832
Name   traD_LVQ73_RS26345_pKP106-2 insolico UniProt ID   _
Length   770 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 770 a.a.        Molecular weight: 85974.10 Da        Isoelectric Point: 5.1149

>WP_013023832.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacterales]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF

  Protein domains


Predicted by InterproScan.

(172-560)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 91042..110393

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LVQ73_RS26845 (LVQ73_26820) 86144..86356 + 213 WP_013023815 hypothetical protein -
LVQ73_RS26850 (LVQ73_26825) 86367..86591 + 225 WP_004152719 hypothetical protein -
LVQ73_RS26855 (LVQ73_26830) 86672..86992 + 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
LVQ73_RS26860 (LVQ73_26835) 86982..87260 + 279 WP_004152721 helix-turn-helix transcriptional regulator -
LVQ73_RS26865 (LVQ73_26840) 87261..87674 + 414 WP_013023817 helix-turn-helix domain-containing protein -
LVQ73_RS26870 (LVQ73_26845) 87810..89018 - 1209 WP_015344990 IS256 family transposase -
LVQ73_RS26875 (LVQ73_26850) 89826..90647 + 822 WP_004152492 DUF932 domain-containing protein -
LVQ73_RS26880 (LVQ73_26855) 90680..91009 + 330 WP_011977736 DUF5983 family protein -
LVQ73_RS26885 (LVQ73_26860) 91042..91527 - 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
LVQ73_RS26890 (LVQ73_26865) 91959..92351 + 393 WP_004194114 conjugal transfer relaxosome DNA-binding protein TraM -
LVQ73_RS26895 (LVQ73_26870) 92581..93282 + 702 WP_004194113 hypothetical protein -
LVQ73_RS26900 (LVQ73_26875) 93368..93568 + 201 WP_004194116 TraY domain-containing protein -
LVQ73_RS26905 (LVQ73_26880) 93637..94005 + 369 WP_004194426 type IV conjugative transfer system pilin TraA -
LVQ73_RS26910 (LVQ73_26885) 94019..94324 + 306 WP_004144424 type IV conjugative transfer system protein TraL traL
LVQ73_RS26915 (LVQ73_26890) 94344..94910 + 567 WP_004144423 type IV conjugative transfer system protein TraE traE
LVQ73_RS26920 (LVQ73_26895) 94897..95637 + 741 WP_013023821 type-F conjugative transfer system secretin TraK traK
LVQ73_RS26925 (LVQ73_26900) 95637..97061 + 1425 WP_004194260 F-type conjugal transfer pilus assembly protein TraB traB
LVQ73_RS26930 (LVQ73_26905) 97175..97759 + 585 WP_013023822 type IV conjugative transfer system lipoprotein TraV traV
LVQ73_RS26935 (LVQ73_26910) 97891..98301 + 411 WP_009309869 hypothetical protein -
LVQ73_RS26940 (LVQ73_26915) 98407..98625 + 219 WP_015344987 hypothetical protein -
LVQ73_RS26945 (LVQ73_26920) 98626..98937 + 312 WP_015344986 hypothetical protein -
LVQ73_RS26950 (LVQ73_26925) 99004..99408 + 405 WP_004197817 hypothetical protein -
LVQ73_RS26955 (LVQ73_26930) 99784..100182 + 399 WP_013609531 hypothetical protein -
LVQ73_RS26960 (LVQ73_26935) 100254..102893 + 2640 WP_013023824 type IV secretion system protein TraC virb4
LVQ73_RS26965 (LVQ73_26940) 102893..103282 + 390 WP_004197815 type-F conjugative transfer system protein TrbI -
LVQ73_RS26970 (LVQ73_26945) 103282..103908 + 627 WP_009309871 type-F conjugative transfer system protein TraW traW
LVQ73_RS26975 (LVQ73_26950) 103950..104339 + 390 WP_004194992 hypothetical protein -
LVQ73_RS26980 (LVQ73_26955) 104336..105325 + 990 WP_009309872 conjugal transfer pilus assembly protein TraU traU
LVQ73_RS26985 (LVQ73_26960) 105338..105976 + 639 WP_011977786 type-F conjugative transfer system pilin assembly protein TrbC trbC
LVQ73_RS26990 (LVQ73_26965) 106035..107990 + 1956 WP_013023827 type-F conjugative transfer system mating-pair stabilization protein TraN traN
LVQ73_RS26995 (LVQ73_26970) 108022..108276 + 255 WP_004152674 conjugal transfer protein TrbE -
LVQ73_RS27000 (LVQ73_26975) 108254..108502 + 249 WP_004152675 hypothetical protein -
LVQ73_RS27005 (LVQ73_26980) 108515..108841 + 327 WP_004152676 hypothetical protein -
LVQ73_RS27010 (LVQ73_26985) 108862..109614 + 753 WP_048337413 type-F conjugative transfer system pilin assembly protein TraF traF
LVQ73_RS27015 (LVQ73_26990) 109625..109864 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
LVQ73_RS27020 (LVQ73_26995) 109836..110393 + 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF


Host bacterium


ID   6711 GenBank   NZ_CP089876
Plasmid name   pKP106-2 Incompatibility group   IncFII
Plasmid size   110438 bp Coordinate of oriT [Strand]   91600..91648 [-]
Host baterium   Klebsiella pneumoniae strain KP106

Cargo genes


Drug resistance gene   blaCTX-M-3, blaTEM-1B, aac(3)-IId, aph(3')-Ia, aph(6)-Id, aph(3'')-Ib, sul2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9