Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106238
Name   oriT1_HKE9|unnamed2 in_silico
Organism   Klebsiella pneumoniae strain HKE9
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP089770 ( 76728..76780 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT1_HKE9|unnamed2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   4198 GenBank   WP_277696121
Name   t4cp2_LVO52_RS26765_HKE9|unnamed2 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73423.99 Da        Isoelectric Point: 9.1273

>WP_277696121.1 type IV secretory system conjugative DNA transfer family protein [Klebsiella pneumoniae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRYHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 1..23544

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LVO52_RS26475 (LVO52_26445) 1..987 + 987 WP_001419739 type IV secretion system protein virB6
LVO52_RS26480 (LVO52_26450) 993..1640 + 648 WP_001419738 type IV secretion system protein -
LVO52_RS26485 (LVO52_26455) 1644..1880 + 237 WP_000750964 EexN family lipoprotein -
LVO52_RS26490 (LVO52_26460) 1927..2736 - 810 WP_001419737 DUF5710 domain-containing protein -
LVO52_RS26495 (LVO52_26465) 2784..3416 + 633 WP_001419736 hypothetical protein -
LVO52_RS26500 (LVO52_26470) 3483..3782 + 300 WP_000835763 TrbM/KikA/MpfK family conjugal transfer protein -
LVO52_RS26505 (LVO52_26475) 3785..5020 + 1236 WP_001419735 TcpQ domain-containing protein -
LVO52_RS26510 (LVO52_26480) 5026..5463 + 438 WP_015387358 type IV pilus biogenesis protein PilM -
LVO52_RS26515 (LVO52_26485) 5803..6201 + 399 WP_001708012 hypothetical protein -
LVO52_RS26520 (LVO52_26490) 6222..6806 + 585 WP_001401693 lytic transglycosylase domain-containing protein virB1
LVO52_RS26525 (LVO52_26495) 6806..7096 + 291 WP_000865479 conjugal transfer protein -
LVO52_RS26530 (LVO52_26500) 7167..7487 + 321 WP_000362081 VirB3 family type IV secretion system protein virB3
LVO52_RS26535 (LVO52_26505) 7493..9850 + 2358 WP_015387356 VirB4 family type IV secretion system protein virb4
LVO52_RS26540 (LVO52_26510) 10014..10748 + 735 WP_000432282 type IV secretion system protein virB8
LVO52_RS26545 (LVO52_26515) 10814..11515 + 702 WP_053882504 TrbG/VirB9 family P-type conjugative transfer protein -
LVO52_RS26550 (LVO52_26520) 11505..12644 + 1140 WP_015387354 TrbI/VirB10 family protein virB10
LVO52_RS26555 (LVO52_26525) 12663..13718 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
LVO52_RS26560 (LVO52_26530) 13734..15692 + 1959 Protein_17 type IV secretory system conjugative DNA transfer family protein -
LVO52_RS26565 (LVO52_26535) 15739..16257 + 519 WP_015387353 YfdA protein virb4
LVO52_RS26570 (LVO52_26540) 16250..17893 + 1644 WP_001035590 PilN family type IVB pilus formation outer membrane protein -
LVO52_RS26575 (LVO52_26545) 17944..19254 + 1311 WP_001420476 type 4b pilus protein PilO2 -
LVO52_RS26580 (LVO52_26550) 19238..19732 + 495 WP_000912551 type IV pilus biogenesis protein PilP -
LVO52_RS26585 (LVO52_26555) 19732..21293 + 1562 Protein_22 ATPase, T2SS/T4P/T4SS family -
LVO52_RS26590 (LVO52_26560) 21284..22393 + 1110 WP_277696118 type II secretion system F family protein -
LVO52_RS26595 (LVO52_26565) 22438..22995 + 558 WP_000095051 type 4 pilus major pilin -
LVO52_RS26600 (LVO52_26570) 23062..23544 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
LVO52_RS26605 (LVO52_26575) 23548..24183 + 636 WP_000934978 A24 family peptidase -
LVO52_RS26610 (LVO52_26580) 24196..25482 + 1287 WP_015057162 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
LVO52_RS27095 25796..26017 + 222 Protein_28 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
LVO52_RS26615 (LVO52_26585) 26430..27554 + 1125 WP_000486719 site-specific integrase -
LVO52_RS26620 (LVO52_26590) 27566..28219 + 654 WP_015387348 hypothetical protein -


Host bacterium


ID   6675 GenBank   NZ_CP089770
Plasmid name   HKE9|unnamed2 Incompatibility group   IncI2
Plasmid size   99554 bp Coordinate of oriT [Strand]   39366..39418 [+]; 76728..76780 [+]
Host baterium   Klebsiella pneumoniae strain HKE9

Cargo genes


Drug resistance gene   blaCTX-M-33, blaCTX-M-55
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -