Detailed information of oriT
oriT
The information of the oriT region
oriTDB ID | 106238 |
Name | oriT1_HKE9|unnamed2 |
Organism | Klebsiella pneumoniae strain HKE9 |
Sequence Completeness | - |
NCBI accession of oriT (coordinates [strand]) | NZ_CP089770 ( 76728..76780 [+], 53 nt) |
oriT length | 53 nt |
IRs (inverted repeats) | _ |
Location of nic site | _ |
Conserved sequence flanking the nic site |
_ |
Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT1_HKE9|unnamed2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure fileT4CP
ID | 4198 | GenBank | WP_277696121 |
Name | t4cp2_LVO52_RS26765_HKE9|unnamed2 | UniProt ID | _ |
Length | 652 a.a. | PDB ID | _ |
Note | Predicted by oriTfinder 2.0 |
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73423.99 Da Isoelectric Point: 9.1273
>WP_277696121.1 type IV secretory system conjugative DNA transfer family protein [Klebsiella pneumoniae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRYHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRYHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 1..23544
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LVO52_RS26475 (LVO52_26445) | 1..987 | + | 987 | WP_001419739 | type IV secretion system protein | virB6 |
LVO52_RS26480 (LVO52_26450) | 993..1640 | + | 648 | WP_001419738 | type IV secretion system protein | - |
LVO52_RS26485 (LVO52_26455) | 1644..1880 | + | 237 | WP_000750964 | EexN family lipoprotein | - |
LVO52_RS26490 (LVO52_26460) | 1927..2736 | - | 810 | WP_001419737 | DUF5710 domain-containing protein | - |
LVO52_RS26495 (LVO52_26465) | 2784..3416 | + | 633 | WP_001419736 | hypothetical protein | - |
LVO52_RS26500 (LVO52_26470) | 3483..3782 | + | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
LVO52_RS26505 (LVO52_26475) | 3785..5020 | + | 1236 | WP_001419735 | TcpQ domain-containing protein | - |
LVO52_RS26510 (LVO52_26480) | 5026..5463 | + | 438 | WP_015387358 | type IV pilus biogenesis protein PilM | - |
LVO52_RS26515 (LVO52_26485) | 5803..6201 | + | 399 | WP_001708012 | hypothetical protein | - |
LVO52_RS26520 (LVO52_26490) | 6222..6806 | + | 585 | WP_001401693 | lytic transglycosylase domain-containing protein | virB1 |
LVO52_RS26525 (LVO52_26495) | 6806..7096 | + | 291 | WP_000865479 | conjugal transfer protein | - |
LVO52_RS26530 (LVO52_26500) | 7167..7487 | + | 321 | WP_000362081 | VirB3 family type IV secretion system protein | virB3 |
LVO52_RS26535 (LVO52_26505) | 7493..9850 | + | 2358 | WP_015387356 | VirB4 family type IV secretion system protein | virb4 |
LVO52_RS26540 (LVO52_26510) | 10014..10748 | + | 735 | WP_000432282 | type IV secretion system protein | virB8 |
LVO52_RS26545 (LVO52_26515) | 10814..11515 | + | 702 | WP_053882504 | TrbG/VirB9 family P-type conjugative transfer protein | - |
LVO52_RS26550 (LVO52_26520) | 11505..12644 | + | 1140 | WP_015387354 | TrbI/VirB10 family protein | virB10 |
LVO52_RS26555 (LVO52_26525) | 12663..13718 | + | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
LVO52_RS26560 (LVO52_26530) | 13734..15692 | + | 1959 | Protein_17 | type IV secretory system conjugative DNA transfer family protein | - |
LVO52_RS26565 (LVO52_26535) | 15739..16257 | + | 519 | WP_015387353 | YfdA protein | virb4 |
LVO52_RS26570 (LVO52_26540) | 16250..17893 | + | 1644 | WP_001035590 | PilN family type IVB pilus formation outer membrane protein | - |
LVO52_RS26575 (LVO52_26545) | 17944..19254 | + | 1311 | WP_001420476 | type 4b pilus protein PilO2 | - |
LVO52_RS26580 (LVO52_26550) | 19238..19732 | + | 495 | WP_000912551 | type IV pilus biogenesis protein PilP | - |
LVO52_RS26585 (LVO52_26555) | 19732..21293 | + | 1562 | Protein_22 | ATPase, T2SS/T4P/T4SS family | - |
LVO52_RS26590 (LVO52_26560) | 21284..22393 | + | 1110 | WP_277696118 | type II secretion system F family protein | - |
LVO52_RS26595 (LVO52_26565) | 22438..22995 | + | 558 | WP_000095051 | type 4 pilus major pilin | - |
LVO52_RS26600 (LVO52_26570) | 23062..23544 | + | 483 | WP_001258095 | lytic transglycosylase domain-containing protein | virB1 |
LVO52_RS26605 (LVO52_26575) | 23548..24183 | + | 636 | WP_000934978 | A24 family peptidase | - |
LVO52_RS26610 (LVO52_26580) | 24196..25482 | + | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
LVO52_RS27095 | 25796..26017 | + | 222 | Protein_28 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
LVO52_RS26615 (LVO52_26585) | 26430..27554 | + | 1125 | WP_000486719 | site-specific integrase | - |
LVO52_RS26620 (LVO52_26590) | 27566..28219 | + | 654 | WP_015387348 | hypothetical protein | - |
Host bacterium
ID | 6675 | GenBank | NZ_CP089770 |
Plasmid name | HKE9|unnamed2 | Incompatibility group | IncI2 |
Plasmid size | 99554 bp | Coordinate of oriT [Strand] | 39366..39418 [+]; 76728..76780 [+] |
Host baterium | Klebsiella pneumoniae strain HKE9 |
Cargo genes
Drug resistance gene | blaCTX-M-33, blaCTX-M-55 |
Virulence gene | - |
Metal resistance gene | - |
Degradation gene | - |
Symbiosis gene | - |
Anti-CRISPR | - |