Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106237
Name   oriT_HKE9|unnamed1 in_silico
Organism   Klebsiella pneumoniae strain HKE9
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP089769 (77362..77389 [-], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_HKE9|unnamed1
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   4179 GenBank   WP_227621963
Name   mobH_LVO52_RS26065_HKE9|unnamed1 insolico UniProt ID   _
Length   818 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 818 a.a.        Molecular weight: 92185.39 Da        Isoelectric Point: 4.5076

>WP_227621963.1 MobH family relaxase [Klebsiella pneumoniae]
MSIISKLFLKIRIALFGGPDHDIIFDTDDEYDIPHTPNKDVQSYLDYPSKPAGITLFSEREILSVHANRL
QEINMYIGLPNSDLSEEAYTFTNLVIKPLMEYTRWIHLLPASENHHHAGTGGLLTHSLETAFLALKFAYS
TELLPIGLQDEEQIRKRRYLYAAFICGLLHDAGKIFDVDVISSTPGVKSTWRPLSSSLMDWAKSNRIFSY
EVIWRKRQANEHSVRAPVFLERCLNDTCLNYLSDVVKERLYDKMLSTLGNYTTSDDFISRCMRTADWHST
GTDTSYRYDKQSGIRASDTAARAIAILKDNISTLNINGFDSSSVRHDRNSPPPVHIMIIGGSVYINEHAA
LDFILNQFKHLGINFPDGDLGRKALTDLLLSGGYIEPYGEQRVAHFFHRGDFTENDIQRMFDEGIKGLSW
FSLLKIKWVGFLFKYDILPESTPGIFSINETNDYVFVDRKGNDTLYVRPLSHGTKSIRLGITQTTDNASV
STADTQRAAESNSTVSDTDNTADSENDEATSGENQQVQENTNKTSLRTDASEPETQEPDSKKPVKTRRKK
GEVSPDEYISRLQHQFKNNAINAHELALIDGVLYVSETHIRSIAPLEEPRLMETGLFVLSLRSGSLDEEF
SIPCNDGKRYVQLTDEVSLVQLRHQPDIREVEMLPLLSPDLFGGVKTDDEGVSFTFPPPLTKVNPEPLPP
ERYEEQTPELNRTEHEPTDIPSADYTDAQEDDVEQFWADYASYSYGDDCINSETGPISQTCENADVDVDV
DVAQEKKSLSERTPDNSTSVHGKPPAEVEDDSELTEEEAQEEDSRLAP

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(88-308)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 1..21218

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LVO52_RS25615 (LVO52_25580) 1..567 + 567 WP_004144423 type IV conjugative transfer system protein TraE traE
LVO52_RS25620 (LVO52_25585) 554..1294 + 741 WP_004152497 type-F conjugative transfer system secretin TraK traK
LVO52_RS25625 (LVO52_25590) 1294..2718 + 1425 WP_159118796 F-type conjugal transfer pilus assembly protein TraB traB
LVO52_RS25630 (LVO52_25595) 2791..3375 + 585 WP_020277945 type IV conjugative transfer system lipoprotein TraV traV
LVO52_RS25635 (LVO52_25600) 3956..4246 + 291 WP_032104549 hypothetical protein -
LVO52_RS25640 (LVO52_25605) 4270..4488 + 219 WP_004195468 hypothetical protein -
LVO52_RS25645 (LVO52_25610) 4489..4821 + 333 Protein_6 hypothetical protein -
LVO52_RS25650 (LVO52_25615) 4866..5270 + 405 WP_032446647 hypothetical protein -
LVO52_RS25655 (LVO52_25620) 5312..5626 + 315 WP_108523849 FmdE family protein -
LVO52_RS25660 (LVO52_25625) 5634..6032 + 399 WP_164995996 hypothetical protein -
LVO52_RS25665 (LVO52_25630) 6104..8743 + 2640 WP_032104555 type IV secretion system protein TraC virb4
LVO52_RS25670 (LVO52_25635) 8743..9132 + 390 WP_004167468 type-F conjugative transfer system protein TrbI -
LVO52_RS25675 (LVO52_25640) 9132..9767 + 636 WP_020325113 type-F conjugative transfer system protein TraW traW
LVO52_RS25680 (LVO52_25645) 9802..10203 + 402 WP_016831047 hypothetical protein -
LVO52_RS25685 (LVO52_25650) 10200..11189 + 990 WP_032104558 conjugal transfer pilus assembly protein TraU traU
LVO52_RS25690 (LVO52_25655) 11210..11386 + 177 WP_162866177 hypothetical protein -
LVO52_RS25695 (LVO52_25660) 11465..12112 + 648 WP_015632510 type-F conjugative transfer system pilin assembly protein TrbC trbC
LVO52_RS25700 (LVO52_25665) 12171..14126 + 1956 WP_032104560 type-F conjugative transfer system mating-pair stabilization protein TraN traN
LVO52_RS25705 (LVO52_25670) 14158..14412 + 255 WP_032104561 conjugal transfer protein TrbE -
LVO52_RS25710 (LVO52_25675) 14390..14638 + 249 WP_032104562 hypothetical protein -
LVO52_RS25715 (LVO52_25680) 14651..14977 + 327 WP_004144402 hypothetical protein -
LVO52_RS25720 (LVO52_25685) 14998..15750 + 753 WP_049016816 type-F conjugative transfer system pilin assembly protein TraF traF
LVO52_RS25725 (LVO52_25690) 15761..16000 + 240 WP_004144400 type-F conjugative transfer system pilin chaperone TraQ -
LVO52_RS25730 (LVO52_25695) 15972..16529 + 558 WP_004152678 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
LVO52_RS25735 (LVO52_25700) 16575..17018 + 444 WP_014343488 F-type conjugal transfer protein TrbF -
LVO52_RS25740 (LVO52_25705) 16996..18375 + 1380 WP_075203337 conjugal transfer pilus assembly protein TraH traH
LVO52_RS25745 (LVO52_25710) 18375..21218 + 2844 WP_159118798 conjugal transfer mating-pair stabilization protein TraG traG
LVO52_RS25750 (LVO52_25715) 21229..21753 + 525 WP_015632518 conjugal transfer entry exclusion protein -
LVO52_RS25755 (LVO52_25720) 22062..22793 + 732 WP_004152629 conjugal transfer complement resistance protein TraT -
LVO52_RS25760 (LVO52_25725) 23155..25458 + 2304 Protein_29 type IV conjugative transfer system coupling protein TraD -

Host bacterium

ID   6674 GenBank   NZ_CP089769
Plasmid name   HKE9|unnamed1 Incompatibility group   IncFII
Plasmid size   161792 bp Coordinate of oriT [Strand]   77362..77389 [-]
Host baterium   Klebsiella pneumoniae strain HKE9

Cargo genes

Drug resistance gene   -
Virulence gene   iucA, iucB, iucC, iucD, iutA, iroB, iroC, iroD, iroN
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -