Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106224
Name   oriT_pKP46-4 in_silico
Organism   Klebsiella pneumoniae strain 46
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP088122 (71510..71591 [+], 82 nt)
oriT length   82 nt
IRs (inverted repeats)      27..32, 35..40  (GCCACC..GGTGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 82 nt

>oriT_pKP46-4
CGGGACAGGATATGTTTTGTATTACCGCCACCACGGTGGCAGCAATCCAAAACTCCTGGTCAGGGCGAAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   4170 GenBank   WP_241462228
Name   Relaxase_LRM33_RS27160_pKP46-4 insolico UniProt ID   _
Length   272 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 272 a.a.        Molecular weight: 31407.56 Da        Isoelectric Point: 8.3594

>WP_241462228.1 relaxase/mobilization nuclease domain-containing protein [Klebsiella pneumoniae]
MNAIIPPKRRDRKSSFVQLVAYVSVRDDVPLKDELKEDERFQRPSRSRQAIFDRLVDYMNRSEGTIIEQI
SDMTPEGDIRCSVDGVICQHNLMSVETAAMEMNSIAMQNTHVKDAVYHYILSWQEDENPSDDQVFDSVKH
SLKRLGMEEHQYVAAIHRDTDNLHVHIAANRVHPVSYRAANVWNDADKLQRTCRELELKHGFKVDNGSWV
RDADNNIVRARKGYRNAPRSRDSLNTSLIKSPFIILQSSMFVSLLMPCSVRRTRHGKNCIRS

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(52-226)


  Protein structure



No available structure.




T4CP

ID   4187 GenBank   WP_032440593
Name   trbC_LRM33_RS27300_pKP46-4 insolico UniProt ID   _
Length   730 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 730 a.a.        Molecular weight: 82679.78 Da        Isoelectric Point: 6.3201

>WP_032440593.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacterales]
MQQKQKPVDAARLQRQVHQSMVEEMAYRTGPLLLAIIAIFGAAIVWPVLLWAAIPVMLVWVPMFMLNEFR
MPARMPMDMDRLDPSTETMRPGKLLGFLPVTKLNRHMEKAAGVFYTGYERTLDGGREIWLRMDDLTRHLI
LMATTGAGKTEMLLGFVLNALCWAKGLIFSDGKAQNDVWFAVASLSRRFGREDDLRLLNYITGGQSRSQR
LLENDKSRQQSNNTNPFALAQETYITQLMDSMMPEAGNDRTWQEKAKGMNQVLTKALIYKSRKEQKVMSQ
RLIQEYLSLDKFAELYLQAEAEEWHEEIRTGLRNYLSTSVPGFDMSLITKPSEWSQEARNQHGYLTSQYN
RMLSLFSDTYGHVFSSGAGDIDLRDVVHNDRILVILIPALELSASEALTLGRLTTSQLAMILSQDLGERM
EGKAEDILVIKKFRDRFPFLWLADEVGSYYSDTIGQLATQVRSLGYALVLAGQDLQKLKTAVGDKLWTLL
GNMFTRIFGTIIDPTETAEFAAKSAGMEYQAIQDSMEYRAGAIGGSYADTGRVTVQEKPKLPFDELQALN
QGEQATVFKGAVIRNNALYIADDDKITDKDVRINRFVEVEWPTYDSLSHLLPAKVRRDRPRPASINRIMA
IVKNDKIRHAPDSMIIQDGVLYAIADEAMYFDEVAPTPPNTVQRATQLLSLAAAVLTETRGRYRVEYPEP
EKLSVKKDELEKYQHIHQSAVTQQADGFSY

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 8063..29996

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
LRM33_RS27175 (LRM33_27175) 3210..3704 - 495 WP_032440571 molybdopterin-dependent oxidoreductase -
LRM33_RS27180 (LRM33_27180) 3697..4626 - 930 WP_032440581 hypothetical protein -
LRM33_RS27185 (LRM33_27185) 4686..5528 - 843 WP_032440572 helix-turn-helix domain-containing protein -
LRM33_RS27190 (LRM33_27190) 6138..6365 + 228 WP_032440573 hypothetical protein -
LRM33_RS27195 (LRM33_27195) 7097..7576 + 480 WP_032440574 lytic transglycosylase domain-containing protein -
LRM33_RS27200 (LRM33_27200) 7602..8066 + 465 WP_225546581 DotD/TraH family lipoprotein -
LRM33_RS27205 (LRM33_27205) 8063..8881 + 819 WP_032440576 type IV secretory system conjugative DNA transfer family protein traI
LRM33_RS27210 (LRM33_27210) 8859..10046 + 1188 WP_322867176 plasmid transfer ATPase TraJ -
LRM33_RS27215 (LRM33_27215) 10043..10309 + 267 WP_032440577 IcmT/TraK family protein traK
LRM33_RS27220 (LRM33_27220) 10327..13740 + 3414 WP_052145516 LPD7 domain-containing protein -
LRM33_RS27225 (LRM33_27225) 13774..14127 + 354 WP_032440584 hypothetical protein traL
LRM33_RS27230 (LRM33_27230) 14199..14867 + 669 WP_032440585 DotI/IcmL/TraM family protein traM
LRM33_RS27235 (LRM33_27235) 14878..15981 + 1104 WP_077264204 DotH/IcmK family type IV secretion protein traN
LRM33_RS27240 (LRM33_27240) 15985..17325 + 1341 WP_032440586 conjugal transfer protein TraO traO
LRM33_RS27245 (LRM33_27245) 17332..18051 + 720 WP_050597333 conjugal transfer protein TraP traP
LRM33_RS27250 (LRM33_27250) 18061..18594 + 534 WP_032440587 conjugal transfer protein TraQ traQ
LRM33_RS27255 (LRM33_27255) 18650..19051 + 402 WP_032440588 DUF6750 family protein traR
LRM33_RS27260 (LRM33_27260) 19095..19658 + 564 WP_045325070 hypothetical protein traT
LRM33_RS27265 (LRM33_27265) 19668..22715 + 3048 WP_032440589 conjugal transfer protein traU
LRM33_RS27270 (LRM33_27270) 22725..23921 + 1197 WP_032440590 conjugal transfer protein TraW traW
LRM33_RS27275 (LRM33_27275) 23918..24499 + 582 WP_050597335 conjugal transfer protein TraX -
LRM33_RS27280 (LRM33_27280) 24541..26685 + 2145 WP_032440591 DotA/TraY family protein traY
LRM33_RS27285 (LRM33_27285) 26751..27374 + 624 WP_032440592 plasmid IncI1-type surface exclusion protein ExcA -
LRM33_RS27290 (LRM33_27290) 27476..28894 + 1419 WP_063666705 hypothetical protein trbA
LRM33_RS27295 (LRM33_27295) 28905..29996 + 1092 WP_050597336 thioredoxin fold domain-containing protein trbB
LRM33_RS27300 (LRM33_27300) 29998..32190 + 2193 WP_032440593 F-type conjugative transfer protein TrbC -
LRM33_RS27305 (LRM33_27305) 32236..32769 + 534 WP_032440594 phospholipase D family protein -
LRM33_RS27310 (LRM33_27310) 32781..33032 + 252 WP_113394424 hypothetical protein -
LRM33_RS27315 (LRM33_27315) 33538..34233 + 696 WP_254910806 RepA family replication protein -

Host bacterium

ID   6661 GenBank   NZ_CP088122
Plasmid name   pKP46-4 Incompatibility group   IncFII
Plasmid size   72636 bp Coordinate of oriT [Strand]   71510..71591 [+]
Host baterium   Klebsiella pneumoniae strain 46

Cargo genes

Drug resistance gene   qnrS1, blaCTX-M-15, blaTEM-1B
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -