Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 106121 |
| Name | oriT_pTagA  |
| Organism | Pseudomonas syringae pv. tagetis strain ICMP 4091 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP092924 (50240..50420 [+], 181 nt) |
| oriT length | 181 nt |
| IRs (inverted repeats) | 79..87, 91..99 (CCAAAGGGG..CCCCTTTGG) 42..47, 56..61 (AAAAAG..CTTTTT) |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 181 nt
>oriT_pTagA
ATCTCGAATTCGCTAAACAGGCACGTTACCGATTGTCTACAAAAAAGAGCTTCGCCTTTTTCGTATCCAATCGACGTGCCAAAGGGGATACCCCTTTGGAACCCCGCAGAGCGGGAAAGCGTTGTCGTTGTCGTTGTTGGTTGTCGTCATTCCAGGTGCCCCCAGGAGGTGATCTTGTGGC
ATCTCGAATTCGCTAAACAGGCACGTTACCGATTGTCTACAAAAAAGAGCTTCGCCTTTTTCGTATCCAATCGACGTGCCAAAGGGGATACCCCTTTGGAACCCCGCAGAGCGGGAAAGCGTTGTCGTTGTCGTTGTTGGTTGTCGTCATTCCAGGTGCCCCCAGGAGGTGATCTTGTGGC
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 4115 | GenBank | WP_055007056 |
| Name | t4cp2_MME58_RS27060_pTagA |
UniProt ID | _ |
| Length | 553 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 553 a.a. Molecular weight: 61671.27 Da Isoelectric Point: 6.5238
>WP_055007056.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Pseudomonas syringae group]
MARAKSKPISPTNPQKRIEEHPAFLLGKHPTEDSFLASYGQQFVMLAAPPGTGKGVGAVIPNLLSYPDSM
VVNDPKFENWEITSGFRAAAGHKVYRFSPERLETHRWNPLSAINRDPLYRLGEIRTIARVLFVSDNPKNQ
EWYNKAGNVFTAVLLFLMETPEMPFTLPQAYEIGSLGTGMGTWAQQIIELRSTGPNALSFEALRELNGVF
EASKNKSSGWSTTVDIVRDVLSVYAEKTVAWAVSGDDIDLSKAREEKMTAYFSVTEGSLKKYGPLMNLFF
TQAIRLNSKVIPEQGGHCADGTLRYKYQLALLMDELAIMGRIEILETAPALTRGAGLRFFFIFQGKDQLR
AIYGEEAANAIMKAIHNEIVFAPGDIKLAEEYSRRLGNTTVRVHNQSLNRQKHQVGAQGQTDSYSEQPRP
LMLPQDINELPYDKQLIFVQGTKTTPALKILARKIFYYEEEVFRSREKLPPPPLPVGDASKIDALTVPVR
TVEAKVAVADTKPMQAEQRQRWNPRDTKASATEVAQAEADKAQPVEVEPDPEPVQADDTSEPM
MARAKSKPISPTNPQKRIEEHPAFLLGKHPTEDSFLASYGQQFVMLAAPPGTGKGVGAVIPNLLSYPDSM
VVNDPKFENWEITSGFRAAAGHKVYRFSPERLETHRWNPLSAINRDPLYRLGEIRTIARVLFVSDNPKNQ
EWYNKAGNVFTAVLLFLMETPEMPFTLPQAYEIGSLGTGMGTWAQQIIELRSTGPNALSFEALRELNGVF
EASKNKSSGWSTTVDIVRDVLSVYAEKTVAWAVSGDDIDLSKAREEKMTAYFSVTEGSLKKYGPLMNLFF
TQAIRLNSKVIPEQGGHCADGTLRYKYQLALLMDELAIMGRIEILETAPALTRGAGLRFFFIFQGKDQLR
AIYGEEAANAIMKAIHNEIVFAPGDIKLAEEYSRRLGNTTVRVHNQSLNRQKHQVGAQGQTDSYSEQPRP
LMLPQDINELPYDKQLIFVQGTKTTPALKILARKIFYYEEEVFRSREKLPPPPLPVGDASKIDALTVPVR
TVEAKVAVADTKPMQAEQRQRWNPRDTKASATEVAQAEADKAQPVEVEPDPEPVQADDTSEPM
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 31411..41589
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MME58_RS26950 (MME58_26950) | 26927..27175 | + | 249 | WP_004662018 | type II toxin-antitoxin system prevent-host-death family antitoxin | - |
| MME58_RS26955 (MME58_26955) | 27188..27538 | + | 351 | WP_020304269 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| MME58_RS26960 (MME58_26960) | 27654..28427 | - | 774 | WP_055005858 | helix-turn-helix transcriptional regulator | - |
| MME58_RS26965 (MME58_26965) | 28536..29636 | + | 1101 | WP_055005859 | polyamine ABC transporter substrate-binding protein | - |
| MME58_RS26970 (MME58_26970) | 29734..29931 | + | 198 | WP_020304272 | hypothetical protein | - |
| MME58_RS26975 (MME58_26975) | 29943..30338 | - | 396 | WP_055005860 | helix-turn-helix transcriptional regulator | - |
| MME58_RS26980 (MME58_26980) | 30555..31067 | + | 513 | WP_055005870 | transcription termination/antitermination NusG family protein | - |
| MME58_RS26985 (MME58_26985) | 31156..31398 | + | 243 | WP_055005861 | hypothetical protein | - |
| MME58_RS26990 (MME58_26990) | 31411..32118 | + | 708 | WP_055005862 | lytic transglycosylase domain-containing protein | virB1 |
| MME58_RS26995 (MME58_26995) | 32118..32453 | + | 336 | WP_025391077 | hypothetical protein | - |
| MME58_RS27000 (MME58_27000) | 32466..32942 | + | 477 | WP_055005863 | VirB3 family type IV secretion system protein | virB3 |
| MME58_RS27005 (MME58_27005) | 32857..35355 | + | 2499 | WP_233591032 | conjugal transfer protein | virb4 |
| MME58_RS27010 (MME58_27010) | 35352..36032 | + | 681 | WP_055005865 | P-type DNA transfer protein VirB5 | - |
| MME58_RS27015 (MME58_27015) | 36048..36254 | + | 207 | WP_005782472 | hypothetical protein | - |
| MME58_RS27020 (MME58_27020) | 36281..37225 | + | 945 | WP_055005866 | type IV secretion system protein | virB6 |
| MME58_RS27025 (MME58_27025) | 37285..37569 | + | 285 | WP_082427332 | conjugal transfer protein | - |
| MME58_RS27030 (MME58_27030) | 37607..38395 | + | 789 | WP_010199854 | type IV secretion system protein | virB8 |
| MME58_RS27035 (MME58_27035) | 38385..39194 | + | 810 | WP_055005867 | P-type conjugative transfer protein VirB9 | virB9 |
| MME58_RS27040 (MME58_27040) | 39181..40548 | + | 1368 | WP_055005868 | TrbI/VirB10 family protein | virB10 |
| MME58_RS27045 (MME58_27045) | 40558..41589 | + | 1032 | WP_104742476 | P-type DNA transfer ATPase VirB11 | virB11 |
| MME58_RS27050 (MME58_27050) | 41599..41955 | + | 357 | WP_010217013 | hypothetical protein | - |
| MME58_RS27055 (MME58_27055) | 42082..42312 | + | 231 | WP_055007055 | hypothetical protein | - |
| MME58_RS27060 (MME58_27060) | 42312..43973 | + | 1662 | WP_055007056 | type IV secretory system conjugative DNA transfer family protein | - |
| MME58_RS27065 (MME58_27065) | 44014..44376 | + | 363 | WP_055007057 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| MME58_RS27070 (MME58_27070) | 44404..46569 | + | 2166 | WP_104742477 | type IA DNA topoisomerase | - |
Host bacterium
| ID | 6558 | GenBank | NZ_CP092924 |
| Plasmid name | pTagA | Incompatibility group | - |
| Plasmid size | 56569 bp | Coordinate of oriT [Strand] | 50240..50420 [+] |
| Host baterium | Pseudomonas syringae pv. tagetis strain ICMP 4091 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |