Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106098
Name   oriT_07-3866|unnamed in_silico
Organism   Escherichia albertii strain 07-3866
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP030782 (78930..79058 [+], 129 nt)
oriT length   129 nt
IRs (inverted repeats)      106..111, 124..129  (TTTAAT..ATTAAA)
 96..104, 118..126  (AATAATGTA..TACATTATT)
 95..100, 112..117  (AAATAA..TTATTT)
 62..67, 75..80  (TGATTT..AAATCA)
 46..53, 66..73  (AAAAACAA..TTGTTTTT)
 44..51, 54..61  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 129 nt

>oriT_07-3866|unnamed
GGTTGGTGGTTCTCACCACCAAAAGCACCGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGTTTTTTAAATCATTGGTTTATGTTCTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1803 GenBank   WP_000124981
Name   WP_000124981_07-3866|unnamed insolico UniProt ID   A0A630FTW9
Length   127 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 127 a.a.        Molecular weight: 14542.59 Da        Isoelectric Point: 5.0278

>WP_000124981.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MARVNLYISNEVHEKINMIVEKRRQEGARDKDISLSGTASMLLELGLRVYDAQMERKESAFNQTEFNKLL
LECVVKTQSTVAKILGIESLSPHVSGNPKFEYASMVDDIREKVSVEMDRFFPKNDDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-126)


  Protein structure


Source ID Structure
AlphaFold DB A0A630FTW9

ID   1804 GenBank   WP_001254386
Name   WP_001254386_07-3866|unnamed insolico UniProt ID   A0A3Z6KJB5
Length   75 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 75 a.a.        Molecular weight: 9005.11 Da        Isoelectric Point: 10.1422

>WP_001254386.1 MULTISPECIES: conjugal transfer relaxosome protein TraY [Gammaproteobacteria]
MRRRNARGGISRTVSVYLDEDTNNRLIKAKDRSGRSKTIEVQIRLRDHLKRFPDFYNEEIFREVTEESES
TFKEL

  Protein domains


Predicted by InterproScan.

TraY domain (TraY)

(14-61)


  Protein structure


Source ID Structure
AlphaFold DB A0A3Z6KJB5


T4CP

ID   4104 GenBank   WP_125317921
Name   traC_CCF18_RS24970_07-3866|unnamed insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99101.73 Da        Isoelectric Point: 5.8486

>WP_125317921.1 type IV secretion system protein TraC [Escherichia albertii]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGIPLCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMKAAA
TQFPLPEGMNLPLTLRHYRVFISYCSPSKKKSRADILEMENLVKIIRASLQGASITTQTADAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNVADNYSNLLNPELSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNEAALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFRGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKENRARIDDVVDFLKNASDSEQYAESPTIRSRLDEMIVLLDQYT
ANGTYGQYFNSDEPSLRDDAKMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNHKVGEFIEKGYRTARRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

TraC protein (TraC_F_IV)

(38-276)

TraG P-loop domain (P-loop_TraG)

(467-771)

Family of unknown function (DUF5934) (DUF5934)

(289-446)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 78358..100873

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CCF18_RS24855 73676..74209 + 534 WP_125317917 single-stranded DNA-binding protein -
CCF18_RS24860 74267..74500 + 234 WP_001478623 DUF905 family protein -
CCF18_RS25190 74493..74662 + 170 Protein_81 hypothetical protein -
CCF18_RS24865 74717..75151 + 435 WP_125317918 conjugation system SOS inhibitor PsiB -
CCF18_RS24870 75148..75909 + 762 Protein_83 plasmid SOS inhibition protein A -
CCF18_RS25660 76082..76234 + 153 Protein_84 DUF5431 family protein -
CCF18_RS24875 76179..76301 + 123 WP_223200913 Hok/Gef family protein -
CCF18_RS25665 76602..76774 - 173 Protein_86 hypothetical protein -
CCF18_RS24885 76834..77122 + 289 Protein_87 hypothetical protein -
CCF18_RS24890 77241..78062 + 822 Protein_88 DUF932 domain-containing protein -
CCF18_RS24895 78358..78948 - 591 WP_338142346 transglycosylase SLT domain-containing protein -
CCF18_RS24905 79287..79670 + 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
CCF18_RS24910 79860..80546 + 687 WP_125317919 PAS domain-containing protein -
CCF18_RS24915 80640..80867 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
CCF18_RS24920 80901..81266 + 366 WP_000340270 type IV conjugative transfer system pilin TraA -
CCF18_RS24925 81281..81592 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
CCF18_RS24930 81614..82180 + 567 WP_000399792 type IV conjugative transfer system protein TraE traE
CCF18_RS24935 82167..82895 + 729 WP_241215851 type-F conjugative transfer system secretin TraK traK
CCF18_RS24940 82895..84322 + 1428 WP_125317920 F-type conjugal transfer pilus assembly protein TraB traB
CCF18_RS24945 84312..84902 + 591 WP_000002787 conjugal transfer pilus-stabilizing protein TraP -
CCF18_RS24950 84889..85086 + 198 WP_001324648 conjugal transfer protein TrbD -
CCF18_RS24955 85098..85349 + 252 WP_001038342 conjugal transfer protein TrbG -
CCF18_RS24960 85346..85861 + 516 WP_000809838 type IV conjugative transfer system lipoprotein TraV traV
CCF18_RS24965 85996..86217 + 222 WP_001278689 conjugal transfer protein TraR -
CCF18_RS24970 86377..89004 + 2628 WP_125317921 type IV secretion system protein TraC virb4
CCF18_RS24975 89001..89387 + 387 WP_000099690 type-F conjugative transfer system protein TrbI -
CCF18_RS24980 89384..90016 + 633 WP_001203720 type-F conjugative transfer system protein TraW traW
CCF18_RS24985 90013..91005 + 993 WP_095858494 conjugal transfer pilus assembly protein TraU traU
CCF18_RS24990 91014..91652 + 639 WP_000777695 type-F conjugative transfer system pilin assembly protein TrbC trbC
CCF18_RS24995 91649..93457 + 1809 WP_000821840 type-F conjugative transfer system mating-pair stabilization protein TraN traN
CCF18_RS25000 93484..93741 + 258 WP_000864336 conjugal transfer protein TrbE -
CCF18_RS25005 93734..94477 + 744 WP_001030381 type-F conjugative transfer system pilin assembly protein TraF traF
CCF18_RS25010 94493..94840 + 348 WP_001287908 conjugal transfer protein TrbA -
CCF18_RS25015 94842..95156 - 315 WP_125317922 toxin ArtA -
CCF18_RS25020 95237..95521 + 285 WP_000624108 type-F conjugative transfer system pilin chaperone TraQ -
CCF18_RS25025 95508..96053 + 546 WP_125317923 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
CCF18_RS25030 95983..96324 + 342 WP_001442101 P-type conjugative transfer protein TrbJ -
CCF18_RS25035 96311..96697 + 387 WP_241215852 F-type conjugal transfer protein TrbF -
CCF18_RS25040 96684..98057 + 1374 WP_000944319 conjugal transfer pilus assembly protein TraH traH
CCF18_RS25045 98054..100873 + 2820 WP_125317925 conjugal transfer mating-pair stabilization protein TraG traG
CCF18_RS25050 100892..101377 + 486 WP_206430478 surface exclusion protein -
CCF18_RS25055 101426..102157 + 732 WP_125317927 conjugal transfer complement resistance protein TraT -

Host bacterium

ID   6535 GenBank   NZ_CP030782
Plasmid name   07-3866|unnamed Incompatibility group   IncFIB
Plasmid size   104269 bp Coordinate of oriT [Strand]   78930..79058 [+]
Host baterium   Escherichia albertii strain 07-3866

Cargo genes

Drug resistance gene   -
Virulence gene   faeC, faeE, faeF, faeH, faeI
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -