Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106089
Name   oriT_pB_F11 in_silico
Organism   Klebsiella pneumoniae strain F11
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP092903 (102891..102940 [+], 50 nt)
oriT length   50 nt
IRs (inverted repeats)      7..14, 17..24  (GCAAAATT..AATTTTGC)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 50 nt

>oriT_pB_F11
AAATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTCATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   4096 GenBank   WP_004152630
Name   traD_F11wdg_RS27260_pB_F11 insolico UniProt ID   _
Length   769 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 769 a.a.        Molecular weight: 85951.02 Da        Isoelectric Point: 5.0632

>WP_004152630.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFVFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSREIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKITEGFIPRRLDTRVDARLSALLEEREAEGSLARALFTPDAPASGPADTDSHAGEQPEPVSQPA
PADMTVSPAPVKAPPTTKMPAAEPSVRATEPPVLRVTTVPLIKPKAAAAAAAASTASSAGIPAAAAGGTE
QELAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 75080..103498

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
F11wdg_RS27260 (F11wdg_pB0081) 75080..77389 - 2310 WP_004152630 type IV conjugative transfer system coupling protein TraD virb4
F11wdg_RS27265 (F11wdg_pB0082) 77749..78480 - 732 WP_004152629 conjugal transfer complement resistance protein TraT -
F11wdg_RS27270 78670..79197 - 528 WP_004153030 hypothetical protein -
F11wdg_RS27275 (F11wdg_pB0083) 79203..82052 - 2850 WP_004178054 conjugal transfer mating-pair stabilization protein TraG traG
F11wdg_RS27280 (F11wdg_pB0084) 82052..83422 - 1371 WP_004178055 conjugal transfer pilus assembly protein TraH traH
F11wdg_RS27285 (F11wdg_pB0085) 83409..83837 - 429 WP_004152689 hypothetical protein -
F11wdg_RS27290 (F11wdg_pB0086) 83830..84402 - 573 WP_004152688 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
F11wdg_RS27295 (F11wdg_pB0087) 84374..84613 - 240 WP_004152687 type-F conjugative transfer system pilin chaperone TraQ -
F11wdg_RS27300 (F11wdg_pB0088) 84624..85376 - 753 WP_004152686 type-F conjugative transfer system pilin assembly protein TraF traF
F11wdg_RS27305 (F11wdg_pB0089) 85397..85723 - 327 WP_004152685 hypothetical protein -
F11wdg_RS28470 85769..85954 - 186 WP_004152684 hypothetical protein -
F11wdg_RS27310 85951..86187 - 237 WP_004152683 conjugal transfer protein TrbE -
F11wdg_RS27315 (F11wdg_pB0090) 86219..88174 - 1956 WP_004153093 type-F conjugative transfer system mating-pair stabilization protein TraN traN
F11wdg_RS27320 (F11wdg_pB0091) 88222..88860 - 639 WP_004152682 type-F conjugative transfer system pilin assembly protein TrbC trbC
F11wdg_RS27325 (F11wdg_pB0092) 88873..89832 - 960 WP_015065634 conjugal transfer pilus assembly protein TraU traU
F11wdg_RS27330 (F11wdg_pB0093) 89876..90502 - 627 WP_004152590 type-F conjugative transfer system protein TraW traW
F11wdg_RS27335 (F11wdg_pB0094) 90502..90891 - 390 WP_004152591 type-F conjugative transfer system protein TrbI -
F11wdg_RS27340 (F11wdg_pB0095) 90891..93530 - 2640 WP_004152592 type IV secretion system protein TraC virb4
F11wdg_RS27345 93602..94000 - 399 WP_004153071 hypothetical protein -
F11wdg_RS27350 (F11wdg_pB0096) 94296..94700 - 405 WP_004152594 hypothetical protein -
F11wdg_RS27355 94767..95084 - 318 WP_004152595 hypothetical protein -
F11wdg_RS27360 95085..95303 - 219 WP_004171484 hypothetical protein -
F11wdg_RS27365 (F11wdg_pB0097) 95327..95617 - 291 WP_004152596 hypothetical protein -
F11wdg_RS27370 (F11wdg_pB0098) 95622..96032 - 411 WP_004152597 lipase chaperone -
F11wdg_RS27375 (F11wdg_pB0099) 96164..96733 - 570 WP_004152598 type IV conjugative transfer system lipoprotein TraV traV
F11wdg_RS27380 (F11wdg_pB0100) 96756..97352 - 597 WP_004152599 conjugal transfer pilus-stabilizing protein TraP -
F11wdg_RS27385 (F11wdg_pB0101) 97345..98769 - 1425 WP_004152600 F-type conjugal transfer pilus assembly protein TraB traB
F11wdg_RS27390 (F11wdg_pB0102) 98769..99509 - 741 WP_004152601 type-F conjugative transfer system secretin TraK traK
F11wdg_RS27395 (F11wdg_pB0103) 99496..100062 - 567 WP_004152602 type IV conjugative transfer system protein TraE traE
F11wdg_RS27400 (F11wdg_pB0104) 100082..100387 - 306 WP_004178059 type IV conjugative transfer system protein TraL traL
F11wdg_RS27405 (F11wdg_pB0105) 100401..100769 - 369 WP_004178060 type IV conjugative transfer system pilin TraA -
F11wdg_RS27410 100823..101194 - 372 WP_004208838 TraY domain-containing protein -
F11wdg_RS27415 101278..101973 - 696 WP_004178061 transcriptional regulator TraJ family protein -
F11wdg_RS27420 (F11wdg_pB0106) 102187..102579 - 393 WP_004178062 conjugal transfer relaxosome DNA-binding protein TraM -
F11wdg_RS27425 (F11wdg_pB0107) 103013..103498 + 486 WP_004178063 transglycosylase SLT domain-containing protein virB1
F11wdg_RS27430 103531..103860 - 330 WP_011977736 DUF5983 family protein -
F11wdg_RS27435 (F11wdg_pB0108) 103893..104714 - 822 WP_004178064 DUF932 domain-containing protein -
F11wdg_RS27440 (F11wdg_pB0110) 105548..105961 - 414 WP_004152722 helix-turn-helix domain-containing protein -
F11wdg_RS27445 (F11wdg_pB0111) 105962..106240 - 279 WP_004152721 helix-turn-helix transcriptional regulator -
F11wdg_RS27450 (F11wdg_pB0112) 106230..106550 - 321 WP_004152720 type II toxin-antitoxin system RelE/ParE family toxin -
F11wdg_RS27455 (F11wdg_pB0113) 106631..106855 - 225 WP_004152719 hypothetical protein -
F11wdg_RS27460 (F11wdg_pB0114) 106866..107078 - 213 WP_004152718 hypothetical protein -
F11wdg_RS27465 (F11wdg_pB0115) 107139..107495 - 357 WP_004152717 hypothetical protein -
F11wdg_RS27470 (F11wdg_pB0117) 108131..108481 - 351 WP_004152758 hypothetical protein -

Host bacterium

ID   6526 GenBank   NZ_CP092903
Plasmid name   pB_F11 Incompatibility group   IncFII
Plasmid size   159322 bp Coordinate of oriT [Strand]   102891..102940 [+]
Host baterium   Klebsiella pneumoniae strain F11

Cargo genes

Drug resistance gene   tet(A), dfrA12, aadA2, qacE, sul1, qnrA1, floR, tet(G), rmtB, blaTEM-1B, blaSHV-12
Virulence gene   htpB
Metal resistance gene   arsB, arsA, arsD, arsR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9