Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   106029
Name   oriT_pRes_C2582 in_silico
Organism   Klebsiella pneumoniae strain C2582
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP079210 (78589..78712 [+], 124 nt)
oriT length   124 nt
IRs (inverted repeats)      101..106, 119..124  (TTTAAT..ATTAAA)
 91..99, 113..121  (AATAATGTA..TACATTATT)
 90..95, 107..112  (AAATAA..TTATTT)
 39..46, 49..56  (GCAAAAAC..GTTTTTGC)
 3..10, 15..22  (TTGGTGGT..ACCACCAA)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 124 nt

>oriT_pRes_C2582
GGTTGGTGGTTCTCACCACCAAAAGCACCACACCCCACGCAAAAACAAGTTTTTGCTGATTTGCTTTTTGAATCATTAGCTTATGTTTTAAATAATGTATTTTAATTTATTTTACATTATTAAA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   4070 GenBank   WP_015059012
Name   traC_KV145_RS29075_pRes_C2582 insolico UniProt ID   _
Length   875 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 875 a.a.        Molecular weight: 99393.22 Da        Isoelectric Point: 6.3465

>WP_015059012.1 MULTISPECIES: type IV secretion system protein TraC [Gammaproteobacteria]
MNNPLEAVTQAVNSLVTALKLPDESAKANEVLGEMSFPQFSRLLPYRDYNQESGLFMNDTTMGFMLEAIP
INGANESIVEALDHMLRTKLPRGVPFCIHLMSSQLVGDRIEYGLREFSWSGEQAERFNAITRAYYMNAAA
TQFPLPEGMNLPLTLRHYRVFFSYCSPSKKKSRADILEMENLVKIIRASLQGASITTQAVDAQAFIDIVG
EMINHNPDSLYPKRRQLDPYSDLNYQCVEDSFDLKVRADYLTLGLRENGRNSTARILNFHLARNPEIAFL
WNMADNYSNLLNPEMSISCPFILTLTLVVEDQVKTHSEANLKYMDLEKKSKTSYAKWFPSVEKEAKEWGE
LRQRLGSGQSSVVSYFLNITAFCKDNNETALEVEQDILNSFRKNGFELISPRFNHMRNFLTCLPFMAGKG
LFKQLKEAGVVQRAESFNVANLMPLVADNPLTPAGLLAPTYRNQLAFIDIFFKGMNNTNYNMAVCGTSGA
GKTGLIQPLIRSVLDSGGFAVVFDMGDGYKSLCENMGGVYLDGETLRFNPFANITDIDQSAERVRDQLSV
MASPNGNLDEVHEGLLLQAVRASWLAKKKQARIDDVVDFLKNARDNDQYVESPTIRSRLDEMIVLLDQYT
ANGTYGRYFNSDEPSLRDDARMVVLELGGLEDRPSLLVAVMFSLIIYIENRMYRTPRNLKKLNVIDEGWR
LLDFKNRKVGEFIQKGYRTCRRHTGAYITITQNIVDFDSDKASSAARAAWGNSSYKIILKQSAKEFAKYN
QLYPDQFLPLQRDMIGKFGAAKDQWFSSFLLQVENHSSWHRLFVDPLSRAMYSSDGPDFEFVQQKRKEGL
SIHEAVWQLAWKKSGPEMASLEAWLEEHEKYRSVA

  Protein domains


Predicted by InterproScan.

(290-446)

(467-771)

(38-276)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 78017..90660

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KV145_RS28970 (KV145_28875) 73989..74423 + 435 WP_000845953 conjugation system SOS inhibitor PsiB -
KV145_RS28975 (KV145_28880) 74420..75139 + 720 WP_001276217 plasmid SOS inhibition protein A -
KV145_RS28980 75361..75510 + 150 Protein_108 plasmid maintenance protein Mok -
KV145_RS28985 (KV145_28885) 75452..75577 + 126 WP_001372321 type I toxin-antitoxin system Hok family toxin -
KV145_RS28990 (KV145_28890) 75896..76192 - 297 Protein_110 hypothetical protein -
KV145_RS28995 (KV145_28895) 76492..76788 + 297 WP_001272251 hypothetical protein -
KV145_RS29000 (KV145_28900) 76899..77720 + 822 WP_001234445 DUF932 domain-containing protein -
KV145_RS29005 (KV145_28905) 78017..78664 - 648 WP_015059008 transglycosylase SLT domain-containing protein virB1
KV145_RS29010 (KV145_28910) 78941..79324 + 384 WP_000124981 conjugal transfer relaxosome DNA-binding protein TraM -
KV145_RS29015 (KV145_28915) 79515..80201 + 687 WP_015059009 PAS domain-containing protein -
KV145_RS29020 (KV145_28920) 80295..80522 + 228 WP_001254386 conjugal transfer relaxosome protein TraY -
KV145_RS29025 (KV145_28925) 80556..80921 + 366 WP_021519752 type IV conjugative transfer system pilin TraA -
KV145_RS29030 (KV145_28930) 80936..81247 + 312 WP_000012106 type IV conjugative transfer system protein TraL traL
KV145_RS29035 (KV145_28935) 81269..81835 + 567 WP_000399794 type IV conjugative transfer system protein TraE traE
KV145_RS29040 (KV145_28940) 81822..82550 + 729 WP_001230787 type-F conjugative transfer system secretin TraK traK
KV145_RS29045 (KV145_28945) 82550..83977 + 1428 WP_032297072 F-type conjugal transfer pilus assembly protein TraB traB
KV145_RS29050 (KV145_28950) 83967..84557 + 591 WP_000002778 conjugal transfer pilus-stabilizing protein TraP -
KV145_RS29055 (KV145_28955) 84544..84741 + 198 WP_001324648 conjugal transfer protein TrbD -
KV145_RS29060 (KV145_28960) 84753..85004 + 252 WP_001038341 conjugal transfer protein TrbG -
KV145_RS29065 (KV145_28965) 85001..85516 + 516 WP_062955122 type IV conjugative transfer system lipoprotein TraV traV
KV145_RS29070 (KV145_28970) 85651..85872 + 222 WP_001278692 conjugal transfer protein TraR -
KV145_RS29075 (KV145_28975) 86032..88659 + 2628 WP_015059012 type IV secretion system protein TraC virb4
KV145_RS29080 (KV145_28980) 88656..89042 + 387 WP_015059013 type-F conjugative transfer system protein TrbI -
KV145_RS29085 (KV145_28985) 89039..89671 + 633 WP_001203735 type-F conjugative transfer system protein TraW traW
KV145_RS29090 (KV145_28990) 89668..90660 + 993 WP_000830838 conjugal transfer pilus assembly protein TraU traU
KV145_RS29095 (KV145_28995) 90687..90995 + 309 WP_000412447 hypothetical protein -
KV145_RS29100 (KV145_29000) 91058..91579 + 522 WP_015059014 hypothetical protein -
KV145_RS29105 (KV145_29005) 91606..92121 + 516 Protein_133 type-F conjugative transfer system pilin assembly protein TrbC -
KV145_RS29110 (KV145_29010) 92183..92887 + 705 WP_001067855 IS6-like element IS26 family transposase -
KV145_RS29115 (KV145_29015) 92833..93264 - 432 WP_011977770 class II aldolase/adducin family protein -
KV145_RS29120 (KV145_29020) 93257..94509 - 1253 Protein_136 3-oxo-tetronate kinase -
KV145_RS29125 (KV145_29025) 94521..95423 - 903 WP_002903955 L-threonate dehydrogenase -


Host bacterium


ID   6466 GenBank   NZ_CP079210
Plasmid name   pRes_C2582 Incompatibility group   IncFII
Plasmid size   128399 bp Coordinate of oriT [Strand]   78589..78712 [+]
Host baterium   Klebsiella pneumoniae strain C2582

Cargo genes


Drug resistance gene   blaCTX-M-65, fosA3, blaTEM-1B, rmtB, blaSHV-12, blaKPC-2
Virulence gene   -
Metal resistance gene   merE, merD, merA, merP, merT, merR
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9