Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   106010
Name   oriT_pKpn14-1 in_silico
Organism   Klebsiella pneumoniae strain Kpn-14
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP047701 (254459..254486 [+], 28 nt)
oriT length   28 nt
IRs (inverted repeats)      16..21, 23..28  (ATCAGA..TCTGAT)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 28 nt

>oriT_pKpn14-1
AGTTTGGTGCTTATGATCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   4054 GenBank   WP_004181913
Name   traD_GVI79_RS26880_pKpn14-1 insolico UniProt ID   _
Length   708 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 708 a.a.        Molecular weight: 79493.94 Da        Isoelectric Point: 8.4986

>WP_004181913.1 MULTISPECIES: conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MKRRSRNNLHTQEMLYRPALEFRSALILILFSAYVLIDSWTSKYGISEIPFYCSLGLIAMAGWRVWHGVP
VFIAHWRLFHRTMDFLSLEDFRMINNAHFFADDRKYQKLVSLQESGGAPSKKSVYQLLRKKEKIVIPQRT
TFLCNGFKWGPEHSERTYQVHNLSSDMHEVQLPFILNPVTRHYRKLAFDLGGNYAIFGVDKKIPIFVNEE
NFFGHTLITGNVGTGKTVLQRLLSSSMLHLGHIVLVVDPKNDYQWQEGLKEECESLGKPFMHFHAGNPST
SVSYDVSANYVKDTDLSARIMSIISGTEGGEDPFVRIAEGLVTTAIGALKLGGTKPTIQNIYYAIRSKQD
LIVTTRNALRGFYTYHLGADWHLTVQVSPNLTFADEIEKLKEYFHCNYFEDNSPKNMHGMDTVLECFKYI
SGDESHYYKITASLMPMLKRLSQTPMDILLSANDVENPDRNIVNSHGLFNSGGVLYISLDGLSDPATARD
LSQLITSDIAAEAGSRYNTASDLSTVPRVSIFIDEAHQAVNMQLINLLAQGRAAKIALFISTQTISDFVS
ATSADTADRLTGLCNNYISTRVTDAKTQELVLTKVGQTNVSMNQVTYTTSAGTKQSHTDFNGSISERKST
TMVNAIPQELLSMIPTLHFIACLQDGRKIVGQMPITVPGKSMRRSTTVFDMVTTSPYKLKMRRNLNVEEI
LSKSQKVG

  Protein domains


Predicted by InterproScan.

AAA-like domain (AAA_10)

(214-261)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(473-655)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 105029..124891

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GVI79_RS26990 (GVI79_26625) 101497..102357 + 861 WP_000344784 TniB family NTP-binding protein -
GVI79_RS26995 (GVI79_26630) 102408..103370 - 963 Protein_107 IS3-like element IS1353 family transposase -
GVI79_RS27000 (GVI79_26635) 103424..104128 - 705 WP_001067855 IS6-like element IS26 family transposase -
GVI79_RS27005 (GVI79_26645) 104190..105032 - 843 Protein_109 TraU family protein -
GVI79_RS27010 (GVI79_26650) 105029..106390 - 1362 WP_004026523 TrbC family F-type conjugative pilus assembly protein traW
GVI79_RS27015 (GVI79_26655) 106377..106901 - 525 WP_025368608 signal peptidase I -
GVI79_RS27020 (GVI79_26660) 107039..111280 - 4242 WP_004181790 Ig-like domain-containing protein -
GVI79_RS27025 (GVI79_26665) 111408..111944 - 537 WP_004181791 hypothetical protein -
GVI79_RS27030 (GVI79_26670) 111932..112336 - 405 WP_004181792 hypothetical protein -
GVI79_RS27035 (GVI79_26675) 112311..112769 - 459 WP_004196672 hypothetical protein -
GVI79_RS27040 (GVI79_26680) 113453..114256 + 804 WP_084456101 metallophosphoesterase -
GVI79_RS27045 (GVI79_26685) 114246..114962 + 717 WP_004181794 hypothetical protein -
GVI79_RS27050 (GVI79_26690) 114949..115449 + 501 WP_004181795 hypothetical protein -
GVI79_RS27055 (GVI79_26695) 115421..115837 + 417 WP_014386510 hypothetical protein -
GVI79_RS27060 (GVI79_26700) 115864..118581 - 2718 WP_108430146 TraC family protein virb4
GVI79_RS27065 (GVI79_26705) 118626..119363 - 738 WP_004181797 type IV conjugative transfer system lipoprotein TraV traV
GVI79_RS27070 (GVI79_26710) 119373..120224 - 852 WP_025368610 disulfide isomerase -
GVI79_RS27075 (GVI79_26715) 120227..120691 - 465 WP_004181799 hypothetical protein -
GVI79_RS27080 (GVI79_26720) 120694..122064 - 1371 WP_032437928 TrbI/VirB10 family protein traB
GVI79_RS27085 (GVI79_26725) 122024..122542 - 519 WP_014386508 hypothetical protein -
GVI79_RS27090 (GVI79_26730) 122539..123708 - 1170 WP_004026506 type-F conjugative transfer system secretin TraK traK
GVI79_RS27095 (GVI79_26735) 123710..124570 - 861 WP_004196647 TraE/TraK family type IV conjugative transfer system protein traE
GVI79_RS27100 (GVI79_26740) 124589..124891 - 303 WP_024198097 type IV conjugative transfer system protein TraL traL
GVI79_RS27105 (GVI79_26745) 124993..125361 - 369 WP_004026504 hypothetical protein -
GVI79_RS27110 (GVI79_26750) 126177..126491 + 315 WP_032437932 hypothetical protein -
GVI79_RS27115 (GVI79_26755) 126636..127304 + 669 WP_014386506 hypothetical protein -
GVI79_RS27120 (GVI79_26760) 127360..128124 + 765 WP_004196640 hypothetical protein -
GVI79_RS27125 (GVI79_26765) 128252..129430 + 1179 WP_004196657 hypothetical protein -
GVI79_RS30730 129472..129600 + 129 WP_004196653 hypothetical protein -

Host bacterium

ID   6447 GenBank   NZ_CP047701
Plasmid name   pKpn14-1 Incompatibility group   IncHI1B
Plasmid size   279435 bp Coordinate of oriT [Strand]   254459..254486 [+]
Host baterium   Klebsiella pneumoniae strain Kpn-14

Cargo genes

Drug resistance gene   blaSHV-1, tet(B), sul1, qacE, ant(3'')-Ia, aph(3')-Ia, aac(3)-IIa, blaTEM-1B
Virulence gene   iucA, iucB, iucC, iutA
Metal resistance gene   merR, merT, merP, merA, merD, merE, terE, terD, terC, terB, terA, terZ, terW
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -