Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105979
Name   oriT_pRHBSTW-00433_3 in_silico
Organism   Klebsiella pneumoniae strain RHBSTW-00433
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP056532 (69408..69456 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  TGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pRHBSTW-00433_3
AATCTGCAAAATTTTAATTTTGCGTAGTGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1780 GenBank   WP_004197733
Name   WP_004197733_pRHBSTW-00433_3 insolico UniProt ID   A0A0E3KB00
Length   129 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 129 a.a.        Molecular weight: 14835.90 Da        Isoelectric Point: 4.6012

>WP_004197733.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Bacteria]
MGKVQAYPSDEVCEKINAIVEKRRMEGAKDKDVSFSSISTMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESVVKTQFSVNKILGIECLSPHVKDDPRWQWKSMVLNIQEDVQEAMRNFFPDEDAEGE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-124)


  Protein structure


Source ID Structure
AlphaFold DB A0A0E3KB00


T4CP

ID   4035 GenBank   WP_009309880
Name   traD_HV193_RS27300_pRHBSTW-00433_3 insolico UniProt ID   _
Length   769 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 769 a.a.        Molecular weight: 85571.58 Da        Isoelectric Point: 5.1733

>WP_009309880.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Enterobacteriaceae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGEQPEPVSQPA
PAVMTVTPAPVKSPPTTKRPAAEPSARTAEPPVLRVTTVPLIKPKAAAAAGTAATASSAGTPAAAAGGTE
QVLAQQSAEQGQAMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDLEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 68850..100055

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HV193_RS27075 (HV193_27095) 63952..64302 + 351 WP_004153414 hypothetical protein -
HV193_RS27080 (HV193_27100) 64932..65285 + 354 WP_004152748 hypothetical protein -
HV193_RS27085 (HV193_27105) 65342..65689 + 348 WP_004152749 hypothetical protein -
HV193_RS27090 (HV193_27110) 65784..65930 + 147 WP_004152750 hypothetical protein -
HV193_RS27095 (HV193_27115) 65981..66814 + 834 WP_004152751 N-6 DNA methylase -
HV193_RS27100 (HV193_27120) 67634..68455 + 822 WP_004152492 DUF932 domain-containing protein -
HV193_RS27105 (HV193_27125) 68488..68817 + 330 WP_011977736 DUF5983 family protein -
HV193_RS27110 (HV193_27130) 68850..69335 - 486 WP_022631514 transglycosylase SLT domain-containing protein virB1
HV193_RS27115 (HV193_27135) 69768..70157 + 390 WP_004197733 conjugal transfer relaxosome DNA-binding protein TraM -
HV193_RS27120 (HV193_27140) 70396..71070 + 675 WP_004197737 hypothetical protein -
HV193_RS27125 (HV193_27145) 71220..71438 + 219 WP_172619300 TraY domain-containing protein -
HV193_RS27130 (HV193_27150) 71488..71856 + 369 WP_042946346 type IV conjugative transfer system pilin TraA -
HV193_RS27135 (HV193_27155) 71870..72175 + 306 WP_004178059 type IV conjugative transfer system protein TraL traL
HV193_RS27140 (HV193_27160) 72191..72757 + 567 WP_020804842 type IV conjugative transfer system protein TraE traE
HV193_RS27145 (HV193_27165) 72744..73484 + 741 WP_064182676 type-F conjugative transfer system secretin TraK traK
HV193_RS27150 (HV193_27170) 73484..74887 + 1404 WP_181469606 F-type conjugal transfer pilus assembly protein TraB traB
HV193_RS27155 (HV193_27175) 74933..75901 - 969 WP_072269234 IS5 family transposase -
HV193_RS27160 (HV193_27180) 75967..76563 + 597 WP_023340943 conjugal transfer pilus-stabilizing protein TraP -
HV193_RS27165 (HV193_27185) 76586..77155 + 570 WP_023316399 type IV conjugative transfer system lipoprotein TraV traV
HV193_RS27170 (HV193_27190) 77287..77697 + 411 WP_023316400 hypothetical protein -
HV193_RS27175 (HV193_27195) 77702..77986 + 285 WP_023316401 hypothetical protein -
HV193_RS27180 (HV193_27200) 78010..78228 + 219 WP_023316402 hypothetical protein -
HV193_RS27185 (HV193_27205) 78229..78540 + 312 WP_023316403 hypothetical protein -
HV193_RS27190 (HV193_27210) 78607..79011 + 405 WP_023316404 hypothetical protein -
HV193_RS27195 (HV193_27215) 79008..79298 + 291 WP_023340940 hypothetical protein -
HV193_RS27200 (HV193_27220) 79306..79704 + 399 WP_074186017 hypothetical protein -
HV193_RS27205 (HV193_27225) 79776..82415 + 2640 WP_042946320 type IV secretion system protein TraC virb4
HV193_RS27210 (HV193_27230) 82412..82804 + 393 WP_080816432 type-F conjugative transfer system protein TrbI -
HV193_RS27215 (HV193_27235) 82804..83430 + 627 WP_020314628 type-F conjugative transfer system protein TraW traW
HV193_RS27220 (HV193_27240) 83474..84433 + 960 WP_029497356 conjugal transfer pilus assembly protein TraU traU
HV193_RS27225 (HV193_27245) 84448..84996 + 549 WP_022631518 hypothetical protein -
HV193_RS27230 (HV193_27250) 84971..85660 - 690 WP_032427592 hypothetical protein -
HV193_RS27235 (HV193_27255) 85717..86319 + 603 WP_022631520 hypothetical protein -
HV193_RS27240 (HV193_27260) 86463..87110 + 648 WP_039698503 type-F conjugative transfer system pilin assembly protein TrbC trbC
HV193_RS27245 (HV193_27265) 87169..89124 + 1956 WP_148866277 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HV193_RS27250 (HV193_27270) 89156..89410 + 255 WP_004195500 conjugal transfer protein TrbE -
HV193_RS27255 (HV193_27275) 89388..89636 + 249 WP_004152675 hypothetical protein -
HV193_RS27260 (HV193_27280) 89649..89975 + 327 WP_004194451 hypothetical protein -
HV193_RS27265 (HV193_27285) 89996..90748 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
HV193_RS27270 (HV193_27290) 90759..90998 + 240 WP_009309875 type-F conjugative transfer system pilin chaperone TraQ -
HV193_RS27275 (HV193_27295) 90970..91542 + 573 WP_063160290 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HV193_RS27280 (HV193_27300) 91535..91963 + 429 WP_004152689 hypothetical protein -
HV193_RS27285 (HV193_27305) 91950..93320 + 1371 WP_009309877 conjugal transfer pilus assembly protein TraH traH
HV193_RS27290 (HV193_27310) 93320..96193 + 2874 WP_048979483 conjugal transfer mating-pair stabilization protein TraG traG
HV193_RS27295 (HV193_27315) 96928..97620 + 693 WP_009309879 hypothetical protein -
HV193_RS27300 (HV193_27320) 97746..100055 + 2310 WP_009309880 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   6416 GenBank   NZ_CP056532
Plasmid name   pRHBSTW-00433_3 Incompatibility group   IncFIB
Plasmid size   111220 bp Coordinate of oriT [Strand]   69408..69456 [-]
Host baterium   Klebsiella pneumoniae strain RHBSTW-00433

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9