Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 105956
• Name: oriT_pRMLUG4_1
• Organism: Staphylococcus lugdunensis strain RMLUG4
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP084441 (5274..5393 [-], 120 nt)
• oriT length: 120 nt
• IRs (inverted repeats): 52..59, 61..68 (TTGGGGAT..ATCCCCAA) 22..29, 34..41 (ATTTTTTC..GAAAAAAT) 1..8, 14..21 (AGTGGCTA..TAGCCACT)
• Location of nic site: _
• Conserved sequence flanking the nic site: _
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 120 nt

>oriT_pRMLUG4_1
AGTGGCTAGCAATTAGCCACTATTTTTTCGTCAGAAAAAATCCTAAGGGGCTTGGGGATTATCCCCAACAAGCTGGCGCGTCTGTCACATTAATGGCTAGCAAAGCCAATGCTTGCCAAA

oriT secondary structure

Predicted by RNAfold.

Relaxase

Relaxase_LE164_RS12710_pRMLUG4_1

• ID: 4013
• GenBank: WP_267262752
• Name: Relaxase_LE164_RS12710_pRMLUG4_1
• UniProt ID: _
• Length: 269 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 269 a.a.
• Molecular weight: 30999.18 Da
• Isoelectric Point: 6.1381

>WP_267262752.1 relaxase/mobilization nuclease domain-containing protein [Staphylococcus lugdunensis]
MATTKLSATKSTSRAINYAEKRAVEKSGLNCDVDYAKSSFKASRELYGKTDGNQGHVIIQSFKPDEVTPE
QCNQLGLELAEKLAPHHQVAVYTHNDTDHVHNHIVINSIDLETGKKFNNNKQALRDVRNFNDEVCRAHNL
SVPERDTAKLRYTQAEKALIEKDQYSWKDDLREKIEKAKDHTSDFKSFSEHLAESAIEFKVRGKNVSYKP
ENVNKWVRGKTLGEDYDKGALEYEFERRDREEKESERDAVAEYTDQFDVDWDAVEHNTK

Protein domains

Predicted by InterproScan.

• Relaxase/Mobilisation nuclease domain (Relaxase) (9-238)

Protein structure

No available structure.

Host bacterium

• ID: 6393
• GenBank: NZ_CP084441
• Plasmid name: pRMLUG4_1
• Incompatibility group: -
• Plasmid size: 31852 bp
• Coordinate of oriT [Strand]: 5274..5393 [-]
• Host baterium: Staphylococcus lugdunensis strain RMLUG4

Cargo genes

• Drug resistance gene: blaZ
• Virulence gene: -
• Metal resistance gene: -
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: AcrIIA21