Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105927
Name   oriT_pOXA-48_P7538 in_silico
Organism   Enterobacter hormaechei strain P7538
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP071830 (9011..9116 [+], 106 nt)
oriT length   106 nt
IRs (inverted repeats)      30..35, 41..46  (CCGCCG..CGGCGG)
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 106 nt

>oriT_pOXA-48_P7538
AGTACGGGACAAGATGTGTTTTTGGAGTACCGCCGACACGCGGCGGCCGTCCAAAAACGTCTTGGTCAGGGCAAGCCCCGACACCCCCTAACGAGGTTAGCTATCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3997 GenBank   WP_004187323
Name   Relaxase_J3S86_RS00085_pOXA-48_P7538 insolico UniProt ID   A0A3U8KUL3
Length   659 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 659 a.a.        Molecular weight: 75179.89 Da        Isoelectric Point: 9.9948

>WP_004187323.1 MULTISPECIES: TraI/MobA(P) family conjugative relaxase [Enterobacterales]
MVIPKIIEGRRDKKSSFGQLIKYMADKPSQELTDTVQPTPETALAVKSDMFEGLNNYLTRKQKVISTPVD
VEPGVQRVVVGDVTCQYNTFSLDGAAQEMNSVSQQSTRCKDPVMHYVLSWPDYEKPNDDQVFDSVKFTLA
SMGMSDHQYVAAIHRDTDNLHVHVAVNRINPQTYKAASSSFTKDTLHQACRLLELKNGWSHSNGAYVVND
RQQIVRNPHSKKERGNWRSLDRINKMENKEGVETLYRYIVGDEQVGGSRQNLIHVSAGLREAKSWDDVHK
TFADIGLRVEKAQGKKGYVITHEHQNQKTAVKASLVFNKAQYTLKSMEERFGEYQPSHIEPAKVSVFKTA
YTPGAYRRDANKRLQRKIERAEERMLLKGRYRAYRNNLPIYSPDKDRIADEYRKIAQHTRLVKNNVRHSV
SDPHTRKLMYNLAEFKRLQAVANLRLSLREERNGFRAANPRLSYREWVEQEALKGDKAALSQMRGFAYSS
RKKEKYKQQLVEQIGFNRTFNAITSHDRDDVAVMASARHGVKPRLLKDGTVIFERDGKPVAADRGHIVLT
ESNGIDKEKTADLAIALTIAGKAKSVRVDGDGEFKELCCNRIVDAAVNHNHPVAQGITFTDAAQQAYAQN
EKHRLIREQNNSKNEMQFRSESDDKFNPK

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(86-334)


  Protein structure


Source ID Structure
AlphaFold DB A0A3U8KUL3


T4CP

ID   4002 GenBank   WP_004206885
Name   t4cp2_J3S86_RS00200_pOXA-48_P7538 insolico UniProt ID   _
Length   695 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 695 a.a.        Molecular weight: 79538.91 Da        Isoelectric Point: 4.8317

>WP_004206885.1 MULTISPECIES: conjugal transfer protein TrbC [Enterobacterales]
MQQESVDSKKVLRPDGSFMEWFLTPNVQFGLLAILTVLGLFLPFTMLLSILILPPLMVAFTDRKFRPPLR
MPKDCEMFDDTLTTETQAEYRLGPIRIPHKVRERKKAKGILYVGYERGRLFGRELWLNMTDLLRHMVFFG
TTGSGKTETFYGFIVNFLLWCRGYCLSDGKADNKLAFATWSLARRFGREDDYYVLNLLTGSIDRFVNLVK
QESIPAQSNSVNLFSVAPPTFIIQLMESMLPQVGGDSAQWQDTAKAMMSALINALCYKRARGELLLSQRT
IQKNMSLPAMAALYVEAKKNGWHSEGYAALESYLENTPGFLLANAEYPETWEARAFEQHNYMSRQFLKTL
SLFNETYGHVFPEDSGDIRMDDIFHNDRILIVMIPSLELSRGEAATLGRLYVTLQRMTISKDLGYQLEGK
KEEVLLTHALNNQAPYGLIYDELGQYFTSGMDTLSAQMRSLEKMGVFSSQDHPSLARGANGEVDSLIANT
RVKYFESIEDRKTFEILRETVGQDYYSELSGQEAEHGTFSKTVREGDLYQIREKDRVNIRELRKQTEGQG
VISFQDALVRSAAFYIPDNEKFSSELPMRINRFIEVLPPSPATLYSIYPERKDDELAETNPDAMRFPPIK
LFGYDKAANSLLEKIEVFYELQCGAISPEEMSVCLFELFAEWLDGTETDDVLYHQEDDLFPMIEM

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 11912..39255

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J3S86_RS00065 (J3S86_00065) 6996..7307 + 312 WP_004187333 hypothetical protein -
J3S86_RS00070 (J3S86_00070) 7440..7976 + 537 WP_004187332 hypothetical protein -
J3S86_RS00075 (J3S86_00075) 8478..8873 - 396 WP_019725163 hypothetical protein -
J3S86_RS00080 8908..9435 + 528 WP_172740549 plasmid mobilization protein MobA -
J3S86_RS00085 (J3S86_00085) 9422..11401 + 1980 WP_004187323 TraI/MobA(P) family conjugative relaxase -
J3S86_RS00090 (J3S86_00090) 11415..11915 + 501 WP_004187320 DotD/TraH family lipoprotein -
J3S86_RS00095 (J3S86_00095) 11912..12691 + 780 WP_004187315 type IV secretory system conjugative DNA transfer family protein traI
J3S86_RS00100 (J3S86_00100) 12702..13865 + 1164 WP_004187313 plasmid transfer ATPase TraJ virB11
J3S86_RS00105 (J3S86_00105) 13855..14115 + 261 WP_004187310 IcmT/TraK family protein traK
J3S86_RS00110 14140..17577 + 3438 WP_015586048 LPD7 domain-containing protein -
J3S86_RS00115 (J3S86_00115) 17543..18055 + 513 WP_011091071 hypothetical protein traL
J3S86_RS00120 (J3S86_00120) 18056..18268 - 213 WP_305953721 Hha/YmoA family nucleoid-associated regulatory protein -
J3S86_RS00125 (J3S86_00125) 18240..18650 - 411 WP_004187465 H-NS family nucleoid-associated regulatory protein -
J3S86_RS00130 (J3S86_00130) 18718..19431 + 714 WP_004187467 DotI/IcmL family type IV secretion protein traM
J3S86_RS00135 (J3S86_00135) 19440..20591 + 1152 WP_004187471 DotH/IcmK family type IV secretion protein traN
J3S86_RS00140 (J3S86_00140) 20603..21952 + 1350 WP_004187474 conjugal transfer protein TraO traO
J3S86_RS00145 (J3S86_00145) 21964..22668 + 705 WP_015060002 conjugal transfer protein TraP traP
J3S86_RS00150 (J3S86_00150) 22692..23222 + 531 WP_004187478 conjugal transfer protein TraQ traQ
J3S86_RS00155 (J3S86_00155) 23239..23628 + 390 WP_004187479 DUF6750 family protein traR
J3S86_RS00160 (J3S86_00160) 23674..24168 + 495 WP_004187480 hypothetical protein -
J3S86_RS00165 (J3S86_00165) 24165..27215 + 3051 WP_004187482 hypothetical protein traU
J3S86_RS00170 (J3S86_00170) 27212..28420 + 1209 WP_011091082 conjugal transfer protein TraW traW
J3S86_RS00175 (J3S86_00175) 28417..29013 + 597 WP_015060003 hypothetical protein -
J3S86_RS00180 (J3S86_00180) 29006..31201 + 2196 WP_015062834 DotA/TraY family protein traY
J3S86_RS00185 (J3S86_00185) 31203..31856 + 654 WP_015060005 hypothetical protein -
J3S86_RS00190 (J3S86_00190) 31925..32167 + 243 WP_023893611 IncL/M type plasmid replication protein RepC -
J3S86_RS00195 (J3S86_00195) 32463..33518 + 1056 WP_015060006 plasmid replication initiator RepA -
J3S86_RS27715 34741..34836 + 96 WP_004206884 DinQ-like type I toxin DqlB -
J3S86_RS00200 (J3S86_00200) 34887..36974 - 2088 WP_004206885 conjugal transfer protein TrbC -
J3S86_RS00205 (J3S86_00205) 36987..37937 - 951 WP_004206886 DsbC family protein trbB
J3S86_RS00210 (J3S86_00210) 37948..39255 - 1308 WP_015059988 hypothetical protein trbA
J3S86_RS00215 (J3S86_00215) 39255..39530 - 276 WP_004206888 lytic transglycosylase domain-containing protein -
J3S86_RS00220 (J3S86_00220) 39755..40138 - 384 WP_019725042 DUF1496 domain-containing protein -
J3S86_RS00225 (J3S86_00225) 40218..40652 + 435 Protein_45 CPBP family intramembrane glutamate endopeptidase -
J3S86_RS00230 (J3S86_00230) 40667..41872 - 1206 WP_025987686 IS4-like element IS10A family transposase -
J3S86_RS00240 (J3S86_00240) 42785..43582 + 798 WP_015059991 OXA-48 family carbapenem-hydrolyzing class D beta-lactamase OXA-48 -

Host bacterium

ID   6364 GenBank   NZ_CP071830
Plasmid name   pOXA-48_P7538 Incompatibility group   IncL/M
Plasmid size   63075 bp Coordinate of oriT [Strand]   9011..9116 [+]
Host baterium   Enterobacter hormaechei strain P7538

Cargo genes

Drug resistance gene   blaOXA-48
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -