Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105897
Name   oriT_pFJMB80144_1 in_silico
Organism   Enterobacter hormaechei strain FUJ80144
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_AP025856 (250057..250311 [-], 255 nt)
oriT length   255 nt
IRs (inverted repeats)      153..158, 160..165  (AAAAGT..ACTTTT)
 122..130, 135..143  (TTAAGGCTT..AAGCCTTAA)
 49..55, 60..66  (GAATTTT..AAAATTC)
Location of nic site      78..79
Conserved sequence flanking the
  nic site    		  TTTGGTTAAA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 255 nt

>oriT_pFJMB80144_1
GGATTTAGGTTTTTTTTTAATCGCTTCACATTTCGTTAGCATGCGCAGGAATTTTTGATAAAATTCTGGTTAGTTTGGTTAAAAAGTGTTACAAGTAAGCGGTGTGGTTGAAGGGATAGATTTAAGGCTTATTCAAGCCTTAAGAAAATACTAAAAGTTACTTTTCACCCTACCGAACACCTAACAAAAAATCCATGTTGAAGATTTGAACAATTGTAATGGCGCAAGGACAATCAGCACATGTCAGAATCTGAT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3982 GenBank   WP_251266345
Name   TraI_2_NGJ60_RS25825_pFJMB80144_1 insolico UniProt ID   _
Length   181 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 181 a.a.        Molecular weight: 20523.58 Da        Isoelectric Point: 6.2129

>WP_251266345.1 TraI domain-containing protein [Enterobacter hormaechei]
MMMNFRALYLCIKRILGIFSSQENDATSVMIEDISSLSPFAQILGDQKYTVPDHPNPEVLKFIEYPTRPT
GIQTFNEQSILSLYREKLHSISMMLAISDSDIRDDAYTFTNLVLKPLVEYVRWIHLLPASENHHHNGIGG
LLSHSLEVAILSLKNAHHSELRPIGYQDEVTCSPLISTPRC

  Protein domains


Predicted by InterproScan.

Putative helicase (TraI_2)

(107-158)


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 2429..11636

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NGJ60_RS24435 (FJMB80144_47860) 1..876 + 876 WP_000594611 RepB family plasmid replication initiator protein -
NGJ60_RS24440 (FJMB80144_47880) 2025..2378 + 354 WP_000423602 hypothetical protein -
NGJ60_RS24445 (FJMB80144_47890) 2396..2746 + 351 WP_001447770 type IV conjugative transfer system protein TraL -
NGJ60_RS24450 (FJMB80144_47900) 2758..3546 + 789 WP_000783153 TraE/TraK family type IV conjugative transfer system protein traE
NGJ60_RS24455 (FJMB80144_47910) 3546..4817 + 1272 WP_000592092 type-F conjugative transfer system secretin TraK traK
NGJ60_RS24460 4819..5280 + 462 WP_000521242 plasmid transfer protein HtdO -
NGJ60_RS24465 (FJMB80144_47930) 5270..6625 + 1356 WP_000351841 IncHI-type conjugal transfer protein TrhB traB
NGJ60_RS24470 (FJMB80144_47940) 6633..7115 + 483 WP_000377632 hypothetical protein -
NGJ60_RS24475 (FJMB80144_47950) 7234..7986 + 753 WP_182911723 protein-disulfide isomerase HtdT -
NGJ60_RS24480 (FJMB80144_47960) 7996..8946 + 951 WP_001022588 IncHI-type conjugal transfer lipoprotein TrhV traV
NGJ60_RS24485 (FJMB80144_47970) 8955..11636 + 2682 WP_000387412 TraC family protein virb4
NGJ60_RS24490 14185..14346 + 162 WP_001371949 hypothetical protein -

Host bacterium

ID   6334 GenBank   NZ_AP025856
Plasmid name   pFJMB80144_1 Incompatibility group   IncHI2A
Plasmid size   356500 bp Coordinate of oriT [Strand]   250057..250311 [-]
Host baterium   Enterobacter hormaechei strain FUJ80144

Cargo genes

Drug resistance gene   sul1, qacE, aac(6')-IIc, blaIMP-1, qnrB6, tet(B)
Virulence gene   -
Metal resistance gene   terW, terZ, terA, terB, terC, terD, terE, merE, merD, merB, merR2, merA, merP, merT, merR1, merR, silE, silR, ncrC, rcnR/yohL, arsC, arsB, arsR, arsH
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -