Detailed information of oriT

oriT

The information of the oriT region

• oriTDB ID: 105829
• Name: oriT_pHS08-175-1
• Organism: Enterobacter hormaechei subsp. steigerwaltii strain 08-175
• Sequence Completeness: -
• NCBI accession of oriT (coordinates [strand]): NZ_CP049291 (63212..63310 [+], 99 nt)
• oriT length: 99 nt
• IRs (inverted repeats): 77..82, 89..94 (AAAAAA..TTTTTT) 77..82, 88..93 (AAAAAA..TTTTTT) 31..38, 41..48 (AGCGTGAT..ATCACGCT) 17..23, 35..41 (TAAATCA..TGATTTA)
• Location of nic site: 59..60
• Conserved sequence flanking the nic site: GGTGTATAGC
• Note: Predicted by oriTfinder 2.0

oriT sequence

• Length: 99 nt

>oriT_pHS08-175-1
TTTGTTTTTTTTCTTTTAAATCAGTGCGATAGCGTGATTTATCACGCTGCGTTAGGTGTATAGCAGGTTAAGGGATAAAAAATCATCTTTTTTTGGTAG

oriT secondary structure

Predicted by RNAfold.

Relaxase

Replic_Relax_G6324_RS24275_pHS08-175-1

• ID: 3937
• GenBank: WP_000130000
• Name: Replic_Relax_G6324_RS24275_pHS08-175-1
• UniProt ID: R4WML4
• Length: 101 a.a.
• Note: Predicted by oriTfinder 2.0

Relaxase protein sequence

• Length: 101 a.a.
• Molecular weight: 11477.11 Da
• Isoelectric Point: 7.5204

>WP_000130000.1 MULTISPECIES: PadR family transcriptional regulator [Pseudomonadota]
MTDKDLYGGLIRLHILHHAAEEPVFGLGIIEELRRHGYEMSAGTVYPMLHGLEKKGYLTSRHERTGRRER
RVYDITEQGRTALADAKTKVKELFGELVEGG

Protein domains

Predicted by InterproScan.

• Transcriptional regulator PadR-like family (PadR) (15-84)

Protein structure

• AlphaFold DB: R4WML4

Host bacterium

• ID: 6266
• GenBank: NZ_CP049291
• Plasmid name: pHS08-175-1
• Incompatibility group: IncA/C2
• Plasmid size: 182177 bp
• Coordinate of oriT [Strand]: 63212..63310 [+]
• Host baterium: Enterobacter hormaechei subsp. steigerwaltii strain 08-175

Cargo genes

• Drug resistance gene: blaTEM-1B, catA1, blaSFO-1, mph(A), tet(A), aph(3')-Ia, aph(3'')-Ib, aph(6)-Id, dfrA12, aadA2, qacE, sul1, armA, msr(E), mph(E)
• Virulence gene: -
• Metal resistance gene: merR, merT, merP, merC, merA, merD, merE, merB
• Degradation gene: -
• Symbiosis gene: -
• Anti-CRISPR: -