Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105785
Name   oriT_p1205-3131 in_silico
Organism   Shigella sonnei strain 1205.3131
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP049178 (62330..62418 [+], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p1205-3131
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3912 GenBank   WP_011264053
Name   nikB_G6O63_RS25040_p1205-3131 insolico UniProt ID   A0A767TAZ8
Length   899 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 899 a.a.        Molecular weight: 103882.34 Da        Isoelectric Point: 7.4198

>WP_011264053.1 MULTISPECIES: IncI1-type relaxase NikB [Enterobacteriaceae]
MNAVIPKKRRDGKSSFEDLVSYVSVRDDMTDEELNLSSSSQAEQPHRSRFSRLVDYATRLRNESFVALVD
VMKDGCEWVNFYGVTCFHNCTSLETAAADMEYIAQQAHYAKDNTDPVFHYILSWQAHESPRPEQIYDSVR
HTLKSLGLGEHQYVSAVHTDTDNLHVHVAVNRVHPVTGYLNCLSWSQEKLSRACRELELKHGFAPDNGCW
VHAPGNRIVRKTAVERDRQNAWTRGKKQTFREYVAQTAVAGLRSEPVNDWLSLHRRLAEDGLYLSQMDGK
FLVMDGWDRNREGVQLDSFGPSWCAEKLMKKMGDYTPVPKDIFSQVEAPGRYNPDFIAADVRPEKIAETE
SLQQYACRHLGERLPEMAREGRLENCQAIHRTLAEAGLWMRVQHGHLVICDGYDHNQTPVRADSVWSLLT
LDNVNQLDGGWQPVPTDIFRQVTPTERFRGRRMESCPATDKEWHRMRTGTGPQGAIKRELFSDKESLWGY
SISHCSPQIEEMITQGEFTWQRCHELFAQQGLMLQKQHHGLVVVDAFNHEQTPVKASSIHPDLTLGRAEP
QAGPFVSAPADLFDRVQPESRYNPELAVSDRYGVSSKRDPMLRRQRREARAEARADLRARYLAWREQWRK
PDLRYGERCREIHQACRLRKSHIRAQYDDPALRKLHYHIAEVQRMQALIRLKEDIRDERQKLIADGKWYP
PSYRQWVEIQAAQGDRAAVSQLRGWDYRDRRKDRSRTTTTDRCVVLCEPGGTPVYGNTGDLEARLQKNGS
VRFRDRRTGEFVCTDYGDRVVFRNHHDRNALADKLDLIAPVLFGRDPRMGFEPEGNDKQFNQVFAEMVAW
HNVTGRTGHEDYRITRPDVDHHREGSERYYRDYIAANSNDDASLPPPEQDKRWEPPSPG

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-314)


  Protein structure


Source ID Structure
AlphaFold DB A0A767TAZ8


Auxiliary protein

ID   1763 GenBank   WP_063119516
Name   WP_063119516_p1205-3131 insolico UniProt ID   _
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12585.55 Da        Isoelectric Point: 10.6897

>WP_063119516.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVKKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure



No available structure.




T4CP

ID   3924 GenBank   WP_011264051
Name   trbC_G6O63_RS25035_p1205-3131 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86954.10 Da        Isoelectric Point: 6.7713

>WP_011264051.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKINVQELIELH
PGEFFSIFRGETVPSASFFIPDDEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTTQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHPTGRPVNGFHHKKNNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 17393..56952

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
G6O63_RS24815 (G6O63_24755) 12455..13522 + 1068 WP_001545759 type IV pilus biogenesis lipoprotein PilL -
G6O63_RS24820 (G6O63_24760) 13522..13959 + 438 WP_001545758 type IV pilus biogenesis protein PilM -
G6O63_RS24825 (G6O63_24765) 13973..15655 + 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
G6O63_RS24830 (G6O63_24770) 15648..16943 + 1296 WP_016245572 type 4b pilus protein PilO2 -
G6O63_RS24835 (G6O63_24775) 16930..17382 + 453 WP_001247333 type IV pilus biogenesis protein PilP -
G6O63_RS24840 (G6O63_24780) 17393..18946 + 1554 WP_001545756 ATPase, T2SS/T4P/T4SS family virB11
G6O63_RS24845 (G6O63_24785) 18959..20044 + 1086 WP_001208802 type II secretion system F family protein -
G6O63_RS24850 (G6O63_24790) 20061..20675 + 615 WP_000908227 type 4 pilus major pilin -
G6O63_RS24855 (G6O63_24795) 20685..21245 + 561 WP_000014005 lytic transglycosylase domain-containing protein virB1
G6O63_RS24860 (G6O63_24800) 21230..21886 + 657 WP_001193549 A24 family peptidase -
G6O63_RS24865 (G6O63_24805) 21874..22980 + 1107 Protein_28 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
G6O63_RS24870 (G6O63_24810) 24821..25975 + 1155 WP_001139958 site-specific integrase -
G6O63_RS24875 (G6O63_24815) 26126..26950 + 825 WP_001545755 conjugal transfer protein TraE traE
G6O63_RS24880 (G6O63_24820) 27036..28238 + 1203 WP_000976353 conjugal transfer protein TraF -
G6O63_RS24885 (G6O63_24825) 28298..28882 + 585 WP_000977522 histidine phosphatase family protein -
G6O63_RS24890 (G6O63_24830) 29277..29735 + 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
G6O63_RS24895 (G6O63_24835) 29732..30550 + 819 WP_097763371 IncI1-type conjugal transfer lipoprotein TraI traI
G6O63_RS24900 (G6O63_24840) 30547..31695 + 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
G6O63_RS24905 (G6O63_24845) 31692..31982 + 291 WP_001314267 hypothetical protein traK
G6O63_RS24910 (G6O63_24850) 31997..32548 + 552 WP_000014586 phospholipase D family protein -
G6O63_RS24915 (G6O63_24855) 32638..36402 + 3765 WP_001141540 LPD7 domain-containing protein -
G6O63_RS24920 (G6O63_24860) 36420..36767 + 348 WP_001055900 conjugal transfer protein traL
G6O63_RS24925 (G6O63_24865) 36764..37456 + 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
G6O63_RS24930 (G6O63_24870) 37467..38450 + 984 WP_001191879 IncI1-type conjugal transfer protein TraN traN
G6O63_RS24935 (G6O63_24875) 38453..39742 + 1290 WP_001271994 conjugal transfer protein TraO traO
G6O63_RS24940 (G6O63_24880) 39742..40446 + 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
G6O63_RS24945 (G6O63_24885) 40446..40973 + 528 WP_001055569 conjugal transfer protein TraQ traQ
G6O63_RS24950 (G6O63_24890) 41024..41428 + 405 WP_000086965 IncI1-type conjugal transfer protein TraR traR
G6O63_RS24955 (G6O63_24895) 41492..41680 + 189 WP_001277253 putative conjugal transfer protein TraS -
G6O63_RS24960 (G6O63_24900) 41664..42464 + 801 WP_107372244 IncI1-type conjugal transfer protein TraT traT
G6O63_RS24965 (G6O63_24905) 42554..45598 + 3045 WP_107372243 IncI1-type conjugal transfer protein TraU traU
G6O63_RS24970 (G6O63_24910) 45598..46212 + 615 WP_000337395 IncI1-type conjugal transfer protein TraV traV
G6O63_RS24975 (G6O63_24915) 46179..47381 + 1203 WP_107372242 IncI1-type conjugal transfer protein TraW traW
G6O63_RS24980 (G6O63_24920) 47410..47994 + 585 WP_001037987 IncI1-type conjugal transfer protein TraX -
G6O63_RS24985 (G6O63_24925) 48091..50259 + 2169 WP_001774191 DotA/TraY family protein traY
G6O63_RS24990 (G6O63_24930) 50333..50983 + 651 WP_001178506 plasmid IncI1-type surface exclusion protein ExcA -
G6O63_RS24995 (G6O63_24935) 51055..51264 - 210 WP_000062603 HEAT repeat domain-containing protein -
G6O63_RS25000 51630..51806 + 177 WP_001054898 hypothetical protein -
G6O63_RS25315 51871..51966 - 96 WP_000609148 DinQ-like type I toxin DqlB -
G6O63_RS25010 (G6O63_24945) 52467..52718 + 252 WP_001291964 hypothetical protein -
G6O63_RS25015 (G6O63_24950) 52790..52942 - 153 WP_001387489 Hok/Gef family protein -
G6O63_RS25020 (G6O63_24955) 53569..54348 + 780 WP_275450201 protein FinQ -
G6O63_RS25025 (G6O63_24960) 54655..55863 + 1209 WP_107372241 IncI1-type conjugal transfer protein TrbA trbA
G6O63_RS25030 (G6O63_24965) 55882..56952 + 1071 WP_000151590 IncI1-type conjugal transfer protein TrbB trbB
G6O63_RS25035 (G6O63_24970) 56945..59236 + 2292 WP_011264051 F-type conjugative transfer protein TrbC -

Host bacterium

ID   6222 GenBank   NZ_CP049178
Plasmid name   p1205-3131 Incompatibility group   IncI1
Plasmid size   86039 bp Coordinate of oriT [Strand]   62330..62418 [+]
Host baterium   Shigella sonnei strain 1205.3131

Cargo genes

Drug resistance gene   blaCTX-M-3
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrVA2