Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105779
Name   oriT_pAUSMDU00010534_03 in_silico
Organism   Shigella sonnei strain AUSMDU00010534
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP045935 (13188..13240 [-], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_pAUSMDU00010534_03
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP

ID   3921 GenBank   WP_000338976
Name   t4cp2_GJE15_RS25450_pAUSMDU00010534_03 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73346.95 Da        Isoelectric Point: 9.3476

>WP_000338976.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQKCFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

Type IV secretory system Conjugative DNA transfer (T4SS-DNA_transf)

(127-591)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 29038..52128

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GJE15_RS26560 25623..25854 + 232 Protein_34 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
GJE15_RS25405 (GJE15_25405) 27142..28386 - 1245 WP_000750517 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
GJE15_RS25410 (GJE15_25410) 28399..29034 - 636 WP_154074676 A24 family peptidase -
GJE15_RS25415 (GJE15_25415) 29038..29520 - 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
GJE15_RS25420 (GJE15_25420) 29587..30144 - 558 WP_000095047 type 4 pilus major pilin -
GJE15_RS25425 (GJE15_25425) 30189..31298 - 1110 WP_000974903 type II secretion system F family protein -
GJE15_RS25430 (GJE15_25430) 31289..32827 - 1539 WP_000466224 ATPase, T2SS/T4P/T4SS family virB11
GJE15_RS25435 (GJE15_25435) 32852..33346 - 495 WP_097739096 type IV pilus biogenesis protein PilP -
GJE15_RS25440 (GJE15_25440) 33330..34652 - 1323 WP_000454142 type 4b pilus protein PilO2 -
GJE15_RS25445 (GJE15_25445) 34691..36334 - 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
GJE15_RS25450 (GJE15_25450) 36385..38343 - 1959 WP_000338976 type IV secretory system conjugative DNA transfer family protein -
GJE15_RS25455 (GJE15_25455) 38359..39414 - 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
GJE15_RS25460 (GJE15_25460) 39433..40572 - 1140 WP_000790641 TrbI/VirB10 family protein virB10
GJE15_RS25465 (GJE15_25465) 40562..41263 - 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
GJE15_RS25470 (GJE15_25470) 41329..42063 - 735 WP_000432283 type IV secretion system protein virB8
GJE15_RS25475 (GJE15_25475) 42229..44586 - 2358 WP_000548953 VirB4 family type IV secretion system protein virb4
GJE15_RS25480 (GJE15_25480) 44592..44912 - 321 WP_000362080 VirB3 family type IV secretion system protein virB3
GJE15_RS26385 44983..45273 - 291 WP_000865479 conjugal transfer protein -
GJE15_RS25490 (GJE15_25490) 45273..45857 - 585 WP_001177117 lytic transglycosylase domain-containing protein virB1
GJE15_RS25495 (GJE15_25495) 45878..46276 - 399 WP_001153666 hypothetical protein -
GJE15_RS25500 (GJE15_25500) 46395..46832 - 438 WP_000539664 type IV pilus biogenesis protein PilM -
GJE15_RS25505 (GJE15_25505) 46838..48073 - 1236 WP_000733398 TcpQ domain-containing protein -
GJE15_RS25510 (GJE15_25510) 48076..48363 - 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
GJE15_RS25515 (GJE15_25515) 48535..49170 - 636 WP_000835770 hypothetical protein -
GJE15_RS25520 (GJE15_25520) 49218..50027 + 810 WP_001005148 DUF5710 domain-containing protein -
GJE15_RS25525 (GJE15_25525) 50250..50474 - 225 WP_000713561 EexN family lipoprotein -
GJE15_RS25530 (GJE15_25530) 50483..51127 - 645 WP_001310442 type IV secretion system protein -
GJE15_RS25535 (GJE15_25535) 51133..52128 - 996 WP_001028541 type IV secretion system protein virB6
GJE15_RS25540 (GJE15_25540) 52132..52389 - 258 WP_000739144 hypothetical protein -
GJE15_RS25545 (GJE15_25545) 52386..52739 - 354 WP_236918887 hypothetical protein -
GJE15_RS25550 (GJE15_25550) 52951..53607 - 657 WP_001243161 hypothetical protein -
GJE15_RS25555 (GJE15_25555) 53792..54235 - 444 WP_000964332 NfeD family protein -
GJE15_RS25560 (GJE15_25560) 54298..55251 - 954 WP_072089442 SPFH domain-containing protein -
GJE15_RS25565 (GJE15_25565) 55297..55491 - 195 WP_001127356 DUF1187 family protein -
GJE15_RS25570 (GJE15_25570) 55484..55936 - 453 WP_000101552 CaiF/GrlA family transcriptional regulator -

Host bacterium

ID   6216 GenBank   NZ_CP045935
Plasmid name   pAUSMDU00010534_03 Incompatibility group   IncI2
Plasmid size   57073 bp Coordinate of oriT [Strand]   13188..13240 [-]
Host baterium   Shigella sonnei strain AUSMDU00010534

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -