Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105754
Name   oriT_p866 in_silico
Organism   Shigella sonnei strain 866
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP022673 (82370..82442 [+], 73 nt)
oriT length   73 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 73 nt

>oriT_p866
GTCGGGGCAAAGCCCTGACCAGGTGGGGAATGTCTGAGTGCGCGTGCGCGGTCCGACATTCCCACATCCTGTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3894 GenBank   WP_000991384
Name   Relaxase_CH310_RS25160_p866 insolico UniProt ID   A0A8H8Z9E5
Length   903 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 903 a.a.        Molecular weight: 104595.99 Da        Isoelectric Point: 7.6377

>WP_000991384.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein [Enterobacteriaceae]
MNAIIPHKRRDGRSSFEDLIAYTSVRDDVQENELTEDSEIKSDVPHRNRFRRLVDYATRLRNEKFVSLID
VMKDGSQWVNFYGVTCFHNCNSLETAAEEMQYKADKAVFSRNDTDPVFHYILSWPAHESPRPEQLFDCVR
HTLKSLELSKHQYVAAVHTDTDNLHVHVAVNRVHPETGYINWLSWSQEKLSRACRELELKHGFAPDNGCF
VHAPGNRIVRKTALVRERRNAWRRGKKQTFREYIAQMSIAGLREEPAQDWLSLHKRLASDGLYITMQEGE
LVVKDGWDRAREGVALSSFGPSWTAEKLGRKLGEYQPVPTDIFSQVGTPGRYDPEAINVDIRPEKVAETE
SLKQYACRHFAERLPEMARNGELESCLDVHRTLAKAGLWMGIQHGHLVLHDGFDKQQTPVRADSVWPLMT
LDYMQDLDGGWQPVPKDIFTQVIPGERFRGRNLGTQAVSDYEWYRIRMGTGPQGAIKRELFSDKESLWGY
TTVQCESLIEDMIAGGNFSWQACHEMFARKGLMLQKQHHGLVIVDAFNHELTPVKASSIHPDLTLSRAEP
QAGPFEIAGADIFERVKPECRYNPELAASDEVELGFRRDPVLRRERREARAAAREDLRARYLAWKEHWRK
PDLRYGERLREIHAACRRRKAYIRVQFRDPQLRKLHYHIAEVQRMQALIRLKESVKEERLSLIAEGKWYP
LSYRQWVEQQAVQGDRAALSQLRGWDYRDRRKDKRRTTNADRCVILCEPGGTPLYEDTGVLEARLQKDGS
VRFRDRRNGELVCVDYGDRVVFYHHQDRNELVDKLNLIAPVLFDREPRMGFEPEGSYQQFNDVFAEMVAW
HNAAGITGSGHFVISRPDVDLHRQRSEQYYHEYIRQQKSISGGHGASYAPVQDNEWTPPSPGM

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(62-315)


  Protein structure



No available structure.




Auxiliary protein

ID   1757 GenBank   WP_001291058
Name   WP_001291058_p866 insolico UniProt ID   A0A7I0L241
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12730.52 Da        Isoelectric Point: 9.9656

>WP_001291058.1 MULTISPECIES: plasmid mobilization protein MobA [Enterobacteriaceae]
MSEKKTRTGSENRKRIVKFTARFTEDEAEIVREKAESSGQTVSTFIRSSSLDKVVNCRTDDRMIDEIMRL
GRLQKHLFVEGKRTGDKEYAEVLVAITEYVNALRRDLMGR

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A7I0L241


T4CP

ID   3908 GenBank   WP_052994818
Name   trbC_CH310_RS24975_p866 insolico UniProt ID   _
Length   767 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 767 a.a.        Molecular weight: 87040.19 Da        Isoelectric Point: 7.3008

>WP_052994818.1 F-type conjugative transfer protein TrbC [Shigella sonnei]
MSQHHVNPDLIHRTAWGNPLWNALHNLNITGLCLAGSIITALIWPLALPVCLLFTLVTSVIFMLQRWRCP
LRMPMTLSLDDPSQDRKVRRSLFSFWPTLFQYEADETFPARGIFYVGYRRINDIGRELWLSMDDLTRHVM
FFATTGGGKTETTFAWLLNPLCWGRGFTFVDGKAQNDTTRTIWYLSRRFGREDDIEVINFMNGGKSRSEI
IQSGEKSRPQSNTWNPFAFSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDMSLVRTPSAWTEEPRKQHAYLSGQFSE
TFTTFAETFGDVFAADAGDIDIRDSIHSDRILIVMIPALDTSAHTTSALGRMFVTQQSMLLARDLGYRLE
GTDAQTLEVKKYKGSFPYICILDEVGAYYTDRIAVEATQVRSLEFSLIMTAQDQERIEGQTSATNTATLM
QNAGTKFAGRIVSDDKTARTVKNAAGEEARARMGSLQRHDGVMGESWVDGNQITIQMESKIDVQDLIRLN
AGEFFTVFQGDVVPSASVYIPDSEKSCDSDPVVINRYISVEAPRLERLRRLVPRTVQRRLPTPEHVSSII
GVLTAKPSRKRRKNRTEPYRIIDTFQRQLVTAQTSLDLLPQYDTDIESRANELWKKAVHTINNTTREERR
VCYITLNRPEEEHSGPEDIPSVKAILNTLLPLEMLLPVPDLTASPPHKKNVAQTPSGGKQESRKKRF

  Protein domains


Predicted by InterproScan.

TraM recognition site of TraD and TraG (TraG-D_C)

(439-528)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 11816..52380

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CH310_RS24730 (CH310_26585) 7884..8297 + 414 WP_124983997 type IV pilus biogenesis protein PilM -
CH310_RS24735 (CH310_26590) 8329..9948 + 1620 WP_001035562 PilN family type IVB pilus formation outer membrane protein -
CH310_RS24740 (CH310_26595) 9969..11264 + 1296 WP_000129883 type 4b pilus protein PilO2 -
CH310_RS24745 (CH310_26600) 11254..11712 + 459 WP_000095885 type IV pilus biogenesis protein PilP -
CH310_RS24750 (CH310_26605) 11816..13324 + 1509 WP_000880805 ATPase, T2SS/T4P/T4SS family virB11
CH310_RS24755 (CH310_26610) 13326..14420 + 1095 WP_000697158 type II secretion system F family protein -
CH310_RS24760 (CH310_26615) 14482..15018 + 537 WP_000111534 type 4 pilus major pilin -
CH310_RS24765 (CH310_26620) 15063..15548 + 486 WP_001080767 lytic transglycosylase domain-containing protein virB1
CH310_RS24770 (CH310_26625) 15564..16190 + 627 WP_000939245 prepilin peptidase -
CH310_RS24775 (CH310_26630) 16208..17569 + 1362 WP_001168171 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
CH310_RS26275 (CH310_26635) 17683..17877 + 195 Protein_18 integrase -
CH310_RS24785 (CH310_26640) 18042..18863 + 822 WP_000845373 hypothetical protein traE
CH310_RS24790 (CH310_26645) 18965..20167 + 1203 WP_000979993 conjugal transfer protein TraF -
CH310_RS24795 (CH310_26650) 20271..20729 + 459 WP_001170111 DotD/TraH family lipoprotein -
CH310_RS24800 (CH310_26655) 20726..21562 + 837 WP_000745049 type IV secretory system conjugative DNA transfer family protein traI
CH310_RS24805 (CH310_26660) 21546..22694 + 1149 WP_000775210 plasmid transfer ATPase TraJ virB11
CH310_RS24810 (CH310_26665) 22691..22981 + 291 WP_000817801 IcmT/TraK family protein traK
CH310_RS24815 (CH310_26670) 23045..27106 + 4062 WP_000842456 LPD7 domain-containing protein -
CH310_RS24820 (CH310_26675) 27123..27473 + 351 WP_001056367 hypothetical protein traL
CH310_RS24825 (CH310_26680) 27485..28180 + 696 WP_001287545 DotI/IcmL family type IV secretion protein traM
CH310_RS24830 (CH310_26685) 28191..29165 + 975 WP_000547386 DotH/IcmK family type IV secretion protein traN
CH310_RS24835 (CH310_26690) 29169..30506 + 1338 WP_001272020 conjugal transfer protein TraO traO
CH310_RS24840 (CH310_26695) 30503..31216 + 714 WP_000787002 conjugal transfer protein TraP traP
CH310_RS24845 (CH310_26700) 31213..31743 + 531 WP_000987021 conjugal transfer protein TraQ traQ
CH310_RS24850 (CH310_26705) 31790..32188 + 399 WP_000088813 DUF6750 family protein traR
CH310_RS26405 (CH310_26710) 32212..32496 + 285 WP_001353683 hypothetical protein -
CH310_RS24860 (CH310_26715) 32603..33229 + 627 WP_000785703 hypothetical protein traT
CH310_RS24870 (CH310_26725) 33524..36568 + 3045 WP_001024769 conjugal transfer protein traU
CH310_RS24875 (CH310_26730) 36568..37188 + 621 WP_000286855 hypothetical protein traV
CH310_RS24880 (CH310_26735) 37146..38351 + 1206 WP_001189548 conjugal transfer protein TraW traW
CH310_RS24885 (CH310_26740) 38348..38917 + 570 WP_000650752 conjugal transfer protein TraX -
CH310_RS24890 (CH310_26745) 38992..41151 + 2160 WP_000691811 DotA/TraY family protein traY
CH310_RS24895 (CH310_26750) 41239..41886 + 648 WP_015056434 plasmid IncI1-type surface exclusion protein ExcA -
CH310_RS24900 (CH310_26755) 42160..43746 + 1587 WP_000004564 TnsA endonuclease N-terminal domain-containing protein -
CH310_RS24905 (CH310_26760) 43884..44036 - 153 WP_001335079 Hok/Gef family protein -
CH310_RS24910 (CH310_26765) 44366..44608 + 243 WP_000650923 hypothetical protein -
CH310_RS24915 (CH310_26770) 44696..44887 + 192 WP_000751583 hypothetical protein -
CH310_RS24920 (CH310_26775) 44899..45267 + 369 WP_001345852 hypothetical protein -
CH310_RS24925 (CH310_26780) 45271..45486 + 216 WP_000266543 hypothetical protein -
CH310_RS24935 45684..46307 - 624 WP_032323932 hypothetical protein -
CH310_RS24940 (CH310_26790) 46467..46886 + 420 WP_052994660 thermonuclease family protein -
CH310_RS24945 (CH310_26795) 46937..48049 + 1113 WP_001300563 IS4-like element IS421 family transposase -
CH310_RS25745 48433..48609 + 177 WP_001054907 hypothetical protein -
CH310_RS26410 48672..48767 - 96 WP_001388983 DinQ-like type I toxin DqlB -
CH310_RS26415 49356..49451 - 96 WP_001388983 DinQ-like type I toxin DqlB -
CH310_RS25750 49504..49650 - 147 WP_001346191 hypothetical protein -
CH310_RS24965 (CH310_26805) 49988..51259 + 1272 WP_042842220 IncI1-type conjugal transfer protein TrbA trbA
CH310_RS24970 (CH310_26810) 51256..52380 + 1125 WP_000152378 DsbC family protein trbB
CH310_RS24975 (CH310_26815) 52361..54664 + 2304 WP_052994818 F-type conjugative transfer protein TrbC -
CH310_RS24995 (CH310_26835) 55528..56343 + 816 WP_001043260 sulfonamide-resistant dihydropteroate synthase Sul2 -
CH310_RS25000 (CH310_26840) 56430..56672 + 243 Protein_58 phosphoglucosamine mutase -

Host bacterium

ID   6191 GenBank   NZ_CP022673
Plasmid name   p866 Incompatibility group   IncB/O/K/Z
Plasmid size   113079 bp Coordinate of oriT [Strand]   82370..82442 [+]
Host baterium   Shigella sonnei strain 866

Cargo genes

Drug resistance gene   sul2, tet(B), ant(3'')-Ia, dfrA1, blaTEM-1A
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -