Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 105744 |
| Name | oriT_p75-02_2  |
| Organism | Shigella sonnei strain 75/02 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP019690 (8877..8929 [-], 53 nt) |
| oriT length | 53 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 53 nt
>oriT_p75-02_2
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
T4CP
| ID | 3904 | GenBank | WP_000338974 |
| Name | t4cp2_BZ172_RS27180_p75-02_2 |
UniProt ID | _ |
| Length | 652 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
T4CP protein sequence
Download Length: 652 a.a. Molecular weight: 73347.89 Da Isoelectric Point: 9.1391
>WP_000338974.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDMSLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
T4SS
T4SS were predicted by using oriTfinder2.
Region 1: 25873..49388
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BZ172_RS27105 (BZ172_28895) | 21198..21851 | - | 654 | WP_021563364 | hypothetical protein | - |
| BZ172_RS27110 (BZ172_28900) | 21863..22987 | - | 1125 | WP_000486716 | site-specific integrase | - |
| BZ172_RS30465 (BZ172_28905) | 23050..23271 | + | 222 | Protein_30 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| BZ172_RS27130 (BZ172_28920) | 23935..25221 | - | 1287 | WP_015057162 | shufflon system plasmid conjugative transfer pilus tip adhesin PilV | - |
| BZ172_RS27135 (BZ172_28925) | 25234..25662 | - | 429 | WP_252988439 | prepilin peptidase | - |
| BZ172_RS27140 (BZ172_28930) | 25873..26355 | - | 483 | WP_094112568 | lytic transglycosylase domain-containing protein | virB1 |
| BZ172_RS27145 (BZ172_28935) | 26421..26978 | - | 558 | WP_000095051 | type 4 pilus major pilin | - |
| BZ172_RS27150 (BZ172_28940) | 27023..28132 | - | 1110 | WP_000974900 | type II secretion system F family protein | - |
| BZ172_RS27155 (BZ172_28945) | 28123..29661 | - | 1539 | WP_000466222 | ATPase, T2SS/T4P/T4SS family | virB11 |
| BZ172_RS27160 (BZ172_28950) | 29686..30180 | - | 495 | WP_064237279 | type IV pilus biogenesis protein PilP | - |
| BZ172_RS27165 (BZ172_28955) | 30164..31486 | - | 1323 | WP_052941534 | type 4b pilus protein PilO2 | - |
| BZ172_RS27170 (BZ172_28960) | 31525..33168 | - | 1644 | WP_001035590 | PilN family type IVB pilus formation outer membrane protein | - |
| BZ172_RS27175 (BZ172_28965) | 33161..33691 | - | 531 | WP_064237280 | sigma 54-interacting transcriptional regulator | virb4 |
| BZ172_RS27180 (BZ172_28970) | 33738..35696 | - | 1959 | WP_000338974 | type IV secretory system conjugative DNA transfer family protein | - |
| BZ172_RS27185 (BZ172_28975) | 35712..36767 | - | 1056 | WP_001059977 | P-type DNA transfer ATPase VirB11 | virB11 |
| BZ172_RS27190 (BZ172_28980) | 36786..37925 | - | 1140 | WP_064237281 | TrbI/VirB10 family protein | virB10 |
| BZ172_RS27195 (BZ172_28985) | 37915..38616 | - | 702 | WP_049824867 | TrbG/VirB9 family P-type conjugative transfer protein | - |
| BZ172_RS27200 (BZ172_28990) | 38682..39416 | - | 735 | WP_000432282 | type IV secretion system protein | virB8 |
| BZ172_RS27210 (BZ172_29000) | 39582..41939 | - | 2358 | WP_000548955 | VirB4 family type IV secretion system protein | virb4 |
| BZ172_RS27215 (BZ172_29005) | 41945..42265 | - | 321 | WP_000362080 | VirB3 family type IV secretion system protein | virB3 |
| BZ172_RS30150 (BZ172_29010) | 42336..42626 | - | 291 | WP_000865479 | conjugal transfer protein | - |
| BZ172_RS27225 (BZ172_29015) | 42626..43210 | - | 585 | WP_064237283 | lytic transglycosylase domain-containing protein | virB1 |
| BZ172_RS27230 (BZ172_29020) | 43231..43629 | - | 399 | WP_001708012 | hypothetical protein | - |
| BZ172_RS27235 (BZ172_29025) | 43748..44185 | - | 438 | WP_000539665 | type IV pilus biogenesis protein PilM | - |
| BZ172_RS27240 (BZ172_29030) | 44191..45426 | - | 1236 | WP_052941530 | toxin co-regulated pilus biosynthesis Q family protein | - |
| BZ172_RS27245 (BZ172_29035) | 45429..45728 | - | 300 | WP_000835763 | TrbM/KikA/MpfK family conjugal transfer protein | - |
| BZ172_RS27250 (BZ172_29040) | 45795..46430 | - | 636 | WP_064237284 | hypothetical protein | - |
| BZ172_RS27255 (BZ172_29045) | 46478..47287 | + | 810 | WP_001419737 | DUF5710 domain-containing protein | - |
| BZ172_RS27260 (BZ172_29050) | 47510..47734 | - | 225 | WP_000713561 | EexN family lipoprotein | - |
| BZ172_RS27265 (BZ172_29055) | 47743..48387 | - | 645 | WP_001310442 | type IV secretion system protein | - |
| BZ172_RS27270 (BZ172_29060) | 48393..49388 | - | 996 | WP_064237285 | type IV secretion system protein | virB6 |
| BZ172_RS27275 (BZ172_29065) | 49392..49649 | - | 258 | WP_000739144 | hypothetical protein | - |
| BZ172_RS27280 (BZ172_29070) | 49646..49948 | - | 303 | WP_001360345 | hypothetical protein | - |
| BZ172_RS27285 (BZ172_29075) | 49964..50215 | - | 252 | WP_015387362 | hypothetical protein | - |
| BZ172_RS27295 (BZ172_29085) | 50363..51025 | - | 663 | WP_001243162 | hypothetical protein | - |
| BZ172_RS30155 | 51036..51206 | - | 171 | WP_000550721 | hypothetical protein | - |
| BZ172_RS27300 (BZ172_29090) | 51210..51653 | - | 444 | WP_000964840 | NfeD family protein | - |
| BZ172_RS27310 (BZ172_29100) | 52033..52986 | - | 954 | WP_072105959 | SPFH domain-containing protein | - |
| BZ172_RS27315 (BZ172_29105) | 53032..53226 | - | 195 | WP_000049865 | DUF1187 family protein | - |
| BZ172_RS27320 (BZ172_29110) | 53219..53725 | - | 507 | WP_001358485 | CaiF/GrlA family transcriptional regulator | - |
Host bacterium
| ID | 6181 | GenBank | NZ_CP019690 |
| Plasmid name | p75-02_2 | Incompatibility group | IncI2 |
| Plasmid size | 59559 bp | Coordinate of oriT [Strand] | 8877..8929 [-] |
| Host baterium | Shigella sonnei strain 75/02 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |