Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105646
Name   oriT1_pAMS-38b in_silico
Organism   Enterobacter hormaechei strain AMS-38
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP051134 (4463..4522 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT1_pAMS-38b
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3830 GenBank   WP_240963622
Name   Relaxase_HDB52_RS24110_pAMS-38b insolico UniProt ID   _
Length   168 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 168 a.a.        Molecular weight: 18987.66 Da        Isoelectric Point: 10.3444

>WP_240963622.1 relaxase/mobilization nuclease domain-containing protein [Enterobacter hormaechei]
MSFAEKDLPPGQREKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGKRLQPYYDRA
DRPRIDAWQTIVNGRLGLHDPNAPENRRALVTPSALPETKQEAAQAITRGLLALASSGELKTRPRTSLRR
WKAQVLRWYAPQKAASALPTRTGGETSD

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(2-123)


  Protein structure



No available structure.




Auxiliary protein

ID   1739 GenBank   WP_023343076
Name   WP_023343076_pAMS-38b insolico UniProt ID   A0A625XR88
Length   161 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 161 a.a.        Molecular weight: 18085.72 Da        Isoelectric Point: 10.0592

>WP_023343076.1 MULTISPECIES: MbeB family mobilization protein [Bacteria]
MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSVLLIASNAAILWWQSQQILDNYVSIREQKSTQAMLSERNSGVQLSTCGEQRRRCV
RVNPEAGRFGEDSSWMILAGK

  Protein domains


Predicted by InterproScan.

MbeB-like, N-term conserved region (MbeB_N)

(1-52)


  Protein structure


Source ID Structure
AlphaFold DB A0A625XR88

ID   1740 GenBank   WP_001445156
Name   WP_001445156_pAMS-38b insolico UniProt ID   K4I175
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11755.49 Da        Isoelectric Point: 7.8963

>WP_001445156.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQVVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure


Source ID Structure
AlphaFold DB K4I175

ID   1739 GenBank   WP_023343076
Name   WP_023343076_pAMS-38b insolico UniProt ID   A0A625XR88
Length   161 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 161 a.a.        Molecular weight: 18085.72 Da        Isoelectric Point: 10.0592

>WP_023343076.1 MULTISPECIES: MbeB family mobilization protein [Bacteria]
MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSVLLIASNAAILWWQSQQILDNYVSIREQKSTQAMLSERNSGVQLSTCGEQRRRCV
RVNPEAGRFGEDSSWMILAGK

  Protein domains


Predicted by InterproScan.

MbeB-like, N-term conserved region (MbeB_N)

(1-52)


  Protein structure


Source ID Structure
AlphaFold DB A0A625XR88


Host bacterium

ID   6083 GenBank   NZ_CP051134
Plasmid name   pAMS-38b Incompatibility group   Col440I
Plasmid size   9522 bp Coordinate of oriT [Strand]   4463..4522 [+]; 9226..9286 [+]
Host baterium   Enterobacter hormaechei strain AMS-38

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -