Detailed information of oriT
oriT
The information of the oriT region
| oriTDB ID | 105646 |
| Name | oriT1_pAMS-38b |
| Organism | Enterobacter hormaechei strain AMS-38 |
| Sequence Completeness | - |
| NCBI accession of oriT (coordinates [strand]) | NZ_CP051134 (4463..4522 [+], 60 nt) |
| oriT length | 60 nt |
| IRs (inverted repeats) | _ |
| Location of nic site | _ |
| Conserved sequence flanking the nic site |
_ |
| Note | Predicted by oriTfinder 2.0 |
oriT sequence
Download Length: 60 nt
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA
Visualization of oriT structure
oriT secondary structure
Predicted by RNAfold.
Download structure file
Relaxase
| ID | 3830 | GenBank | WP_240963622 |
| Name | Relaxase_HDB52_RS24110_pAMS-38b |
UniProt ID | _ |
| Length | 168 a.a. | PDB ID | |
| Note | Predicted by oriTfinder 2.0 | ||
Relaxase protein sequence
Download Length: 168 a.a. Molecular weight: 18987.66 Da Isoelectric Point: 10.3444
MSFAEKDLPPGQREKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGKRLQPYYDRA
DRPRIDAWQTIVNGRLGLHDPNAPENRRALVTPSALPETKQEAAQAITRGLLALASSGELKTRPRTSLRR
WKAQVLRWYAPQKAASALPTRTGGETSD
Protein domains
Predicted by InterproScan.
Protein structure
No available structure.
Auxiliary protein
| ID | 1739 | GenBank | WP_023343076 |
| Name | WP_023343076_pAMS-38b |
UniProt ID | A0A625XR88 |
| Length | 161 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 161 a.a. Molecular weight: 18085.72 Da Isoelectric Point: 10.0592
MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSVLLIASNAAILWWQSQQILDNYVSIREQKSTQAMLSERNSGVQLSTCGEQRRRCV
RVNPEAGRFGEDSSWMILAGK
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A625XR88 |
| ID | 1740 | GenBank | WP_001445156 |
| Name | WP_001445156_pAMS-38b |
UniProt ID | K4I175 |
| Length | 107 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 107 a.a. Molecular weight: 11755.49 Da Isoelectric Point: 7.8963
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQVVAALMAIDAGLERLRHAVLEKGADDDR
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | K4I175 |
| ID | 1739 | GenBank | WP_023343076 |
| Name | WP_023343076_pAMS-38b |
UniProt ID | A0A625XR88 |
| Length | 161 a.a. | PDB ID | _ |
| Note | Predicted by oriTfinder 2.0 | ||
Auxiliary protein sequence
Download Length: 161 a.a. Molecular weight: 18085.72 Da Isoelectric Point: 10.0592
MNSLLTLAKDLEQKSKAQQQSTGEMLKAAFSEHEKSVRAELSESEKRISAAILDHDRKLSSAMSQRTKGM
LRMVSQTWLTIVLVSVLLIASNAAILWWQSQQILDNYVSIREQKSTQAMLSERNSGVQLSTCGEQRRRCV
RVNPEAGRFGEDSSWMILAGK
Protein domains
Predicted by InterproScan.
Protein structure
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A625XR88 |
Host bacterium
| ID | 6083 | GenBank | NZ_CP051134 |
| Plasmid name | pAMS-38b | Incompatibility group | Col440I |
| Plasmid size | 9522 bp | Coordinate of oriT [Strand] | 4463..4522 [+]; 9226..9286 [+] |
| Host baterium | Enterobacter hormaechei strain AMS-38 |
Cargo genes
| Drug resistance gene | - |
| Virulence gene | - |
| Metal resistance gene | - |
| Degradation gene | - |
| Symbiosis gene | - |
| Anti-CRISPR | - |