Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105614
Name   oriT_pSfHH103c in_silico
Organism   Sinorhizobium fredii HH103
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NC_016814 (14284..14340 [-], 57 nt)
oriT length   57 nt
IRs (inverted repeats)      4..9, 23..28  (GGAAAA..TTTTCC)
Location of nic site      36..37
Conserved sequence flanking the
  nic site  
 
 TCCTGCCTCT
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 57 nt

>oriT_pSfHH103c
GCAGGAAAAGGGCGTAGCACATTTTTCCGTATCCTGCCTCTCCAAATTGTAAGGGGA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3815 GenBank   WP_014330872
Name   t4cp2_SFHH103_RS20800_pSfHH103c insolico UniProt ID   _
Length   699 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 699 a.a.        Molecular weight: 77549.52 Da        Isoelectric Point: 9.7506

>WP_014330872.1 type IV secretory system conjugative DNA transfer family protein [Sinorhizobium fredii]
MTKQLQAAYLLFCVGIAFVVWMLGYGLGLQLFYKDGRILETTITSNPFAPIQQLWHYKTSPALQKVALGS
MVPALLMAGLMAYIGLKPTSSPLGDAAFQDIASLRRGKWFRKQGHIFGRIGRNILRTKDDRHHLIIGPTR
SGKGAGYVIPNALMHEGSMIVTDLKGEVFKATAGYRRQNGSQVFLFAPGSEKTNSYNPLDFIRPERGNRT
TDIQNIASILVPENTASENSVWQATAQQVLAGAISYMTESPFYKDRRNLAEVNSFFNSGVDLQALMKYIK
EKEPYLSKFTVESFNSYIALSERAAASALLDIQKAMRPFKNEQIVAATNVTDMDLRAMKRRPISIYLAPN
ITDITLLRPLLTLFVQQVMDLLTLEHDPNSLPVYFLLDEFRQLKRMDEIMTKLPYVAGYNIKLAFIIQDL
KNLDEIYGETSRHSLLGNCGYQLVLGANDQATAEYASRALGKRTIRYQSESRTIELMGLPRRTKVEQIRE
RDLMMPQEVRQMPENKMILLIEGQRPIFGEKLRFFQTQPFKSAEAFSQANIPQVPEVDYLSPKPVPATTP
EYAKGGDPSVEIPSPAPAKDEKPFTAAAAEAAPVKPEPAADEKAAAPAKRTVNKKALRPKPKATAANTGG
AEASASLDAMEARIKAIEEGLKPKAAQLKEVVETKAEKLGDKSPTKRRNIMDIFSATVPDPVEVGVAAE

  Protein domains


Predicted by InterproScan.

(104-533)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 34736..44652

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
SFHH103_RS35320 (SFHH103_04077) 30787..32202 - 1416 WP_014330871 AmmeMemoRadiSam system radical SAM enzyme -
SFHH103_RS38745 32233..32635 - 403 Protein_31 hypothetical protein -
SFHH103_RS20800 (SFHH103_04078) 32640..34739 - 2100 WP_014330872 type IV secretory system conjugative DNA transfer family protein -
SFHH103_RS20805 (SFHH103_04079) 34736..35764 - 1029 WP_014330873 P-type DNA transfer ATPase VirB11 virB11
SFHH103_RS20810 (SFHH103_04080) 35745..36956 - 1212 WP_014330874 type IV secretion system protein VirB10 virB10
SFHH103_RS20815 (SFHH103_04081) 36956..37765 - 810 WP_014330875 P-type conjugative transfer protein VirB9 virB9
SFHH103_RS20820 (SFHH103_04082) 37762..38457 - 696 WP_014330876 type IV secretion system protein virB8
SFHH103_RS20825 (SFHH103_04083) 38490..39518 - 1029 WP_014330877 type IV secretion system protein virB6
SFHH103_RS20830 (SFHH103_04084) 39534..39761 - 228 WP_014330878 hypothetical protein -
SFHH103_RS20835 (SFHH103_04085) 39754..40452 - 699 WP_014330879 type IV secretion system protein -
SFHH103_RS20840 (SFHH103_04086) 40464..41552 - 1089 WP_014330880 lytic transglycosylase domain-containing protein -
SFHH103_RS20845 (SFHH103_04087) 41549..44008 - 2460 WP_014330881 VirB4 family type IV secretion/conjugal transfer ATPase virb4
SFHH103_RS20850 (SFHH103_04088) 44011..44310 - 300 WP_014330882 VirB3 family type IV secretion system protein virB3
SFHH103_RS20855 (SFHH103_04089) 44314..44652 - 339 WP_014330883 TrbC/VirB2 family protein virB2
SFHH103_RS20860 (SFHH103_04090) 44664..45575 - 912 WP_014330884 lytic transglycosylase domain-containing protein -
SFHH103_RS20865 (SFHH103_04091) 45799..46407 + 609 WP_014330885 hypothetical protein -
SFHH103_RS20870 (SFHH103_04092) 46404..46937 + 534 WP_014330886 succinoglycan biosynthesis protein exoi -
SFHH103_RS20875 (SFHH103_04093) 46934..47635 + 702 WP_014330887 thermonuclease family protein -
SFHH103_RS35330 (SFHH103_04095) 48019..48609 + 591 WP_014330889 hypothetical protein -
SFHH103_RS20880 (SFHH103_04096) 48629..49045 + 417 WP_014330890 hypothetical protein -
SFHH103_RS20885 (SFHH103_04097) 49150..49485 - 336 WP_014330891 hypothetical protein -


Host bacterium


ID   6052 GenBank   NC_016814
Plasmid name   pSfHH103c Incompatibility group   -
Plasmid size   144082 bp Coordinate of oriT [Strand]   14284..14340 [-]
Host baterium   Sinorhizobium fredii HH103

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -