Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105441
Name   oriT1_pM297-1.2 in_silico
Organism   Klebsiella pneumoniae strain M297-1
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP051492 ( 216997..217045 [+], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site  
 
 GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT1_pM297-1.2
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3697 GenBank   WP_228294104
Name   traD_HGK25_RS27180_pM297-1.2 insolico UniProt ID   _
Length   768 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 768 a.a.        Molecular weight: 85788.91 Da        Isoelectric Point: 5.1149

>WP_228294104.1 type IV conjugative transfer system coupling protein TraD [Klebsiella pneumoniae]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTSFVFAAVVSLVICIVTFFIASWVLGRKQQS
EDENTGGRQLSDKPKEVARQMKRDGMASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVRAR
GDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQGSG
RTIFAEGAYLMREDKDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKAIR
YLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRVWI
FADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIAEF
AAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLALKY
KPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPADTNSHAGEQPEPVSQPAPA
DMTVSPAPVKAPPTTKMPAEEPSVRATEPSVLRLTTVPLIKPKAAAAAAAAATASSAGTPAAAAGGTEQE
LAQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWLADEQTQRDMQRREEVNINHSHRHDEQDYVEIGGNF

  Protein domains


Predicted by InterproScan.

(170-558)

(32-128)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 48080..76839

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HGK25_RS27180 (HGK25_27720) 48080..50386 - 2307 WP_228294104 type IV conjugative transfer system coupling protein TraD virb4
HGK25_RS28590 50513..51200 - 688 Protein_52 hypothetical protein -
HGK25_RS27190 (HGK25_27730) 51389..52120 - 732 WP_013023830 conjugal transfer complement resistance protein TraT -
HGK25_RS27195 (HGK25_27735) 52306..52839 - 534 WP_014343486 conjugal transfer protein TraS -
HGK25_RS27200 (HGK25_27740) 52842..55686 - 2845 Protein_55 conjugal transfer mating-pair stabilization protein TraG -
HGK25_RS27205 (HGK25_27745) 55686..57055 - 1370 Protein_56 conjugal transfer pilus assembly protein TraH -
HGK25_RS27210 (HGK25_27750) 57033..57472 - 440 Protein_57 F-type conjugal transfer protein TrbF -
HGK25_RS27215 (HGK25_27755) 57518..58075 - 558 WP_013214031 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HGK25_RS27220 (HGK25_27760) 58047..58285 - 239 Protein_59 type-F conjugative transfer system pilin chaperone TraQ -
HGK25_RS27225 (HGK25_27765) 58296..59047 - 752 Protein_60 type-F conjugative transfer system pilin assembly protein TraF -
HGK25_RS27230 (HGK25_27770) 59067..59355 - 289 Protein_61 hypothetical protein -
HGK25_RS27235 (HGK25_27775) 59396..59643 - 248 Protein_62 hypothetical protein -
HGK25_RS27240 (HGK25_27780) 59621..59875 - 255 WP_004152674 conjugal transfer protein TrbE -
HGK25_RS28765 (HGK25_27785) 59907..61852 - 1946 Protein_64 type-F conjugative transfer system mating-pair stabilization protein TraN -
HGK25_RS27250 (HGK25_27790) 61911..62549 - 639 WP_011977786 type-F conjugative transfer system pilin assembly protein TrbC trbC
HGK25_RS27255 (HGK25_27795) 62562..63551 - 990 WP_009309872 conjugal transfer pilus assembly protein TraU traU
HGK25_RS27260 (HGK25_27800) 63548..63937 - 390 WP_004194992 hypothetical protein -
HGK25_RS27265 (HGK25_27805) 63979..64605 - 627 WP_009309871 type-F conjugative transfer system protein TraW traW
HGK25_RS27270 (HGK25_27810) 64605..64994 - 390 WP_004197815 type-F conjugative transfer system protein TrbI -
HGK25_RS27275 (HGK25_27815) 64994..67633 - 2640 WP_013023824 type IV secretion system protein TraC virb4
HGK25_RS27280 (HGK25_27820) 67705..68103 - 399 WP_013609531 hypothetical protein -
HGK25_RS27285 (HGK25_27825) 68479..68883 - 405 WP_004197817 hypothetical protein -
HGK25_RS27290 (HGK25_27830) 68950..69261 - 312 WP_015344986 hypothetical protein -
HGK25_RS27295 (HGK25_27835) 69262..69479 - 218 Protein_74 hypothetical protein -
HGK25_RS27300 (HGK25_27840) 69585..69995 - 411 WP_009309869 hypothetical protein -
HGK25_RS27305 (HGK25_27845) 70127..70711 - 585 WP_013023822 type IV conjugative transfer system lipoprotein TraV traV
HGK25_RS27310 (HGK25_27850) 70825..72248 - 1424 Protein_77 F-type conjugal transfer pilus assembly protein TraB -
HGK25_RS27315 (HGK25_27855) 72248..72988 - 741 WP_013023821 type-F conjugative transfer system secretin TraK traK
HGK25_RS27320 (HGK25_27860) 72975..73540 - 566 Protein_79 type IV conjugative transfer system protein TraE -
HGK25_RS27325 (HGK25_27865) 73560..73863 - 304 Protein_80 type IV conjugative transfer system protein TraL -
HGK25_RS27330 (HGK25_27870) 73877..74245 - 369 WP_004194426 type IV conjugative transfer system pilin TraA -
HGK25_RS27335 (HGK25_27875) 74314..74514 - 201 WP_004194116 TraY domain-containing protein -
HGK25_RS27340 (HGK25_27880) 74600..75301 - 702 WP_004194113 hypothetical protein -
HGK25_RS27345 (HGK25_27885) 75531..75923 - 393 WP_004194114 conjugal transfer relaxosome DNA-binding protein TraM -
HGK25_RS27350 (HGK25_27890) 76354..76839 + 486 WP_001568108 transglycosylase SLT domain-containing protein virB1
HGK25_RS27355 (HGK25_27895) 76872..77201 - 330 WP_011977736 DUF5983 family protein -
HGK25_RS27360 (HGK25_27900) 77234..78051 - 818 Protein_87 DUF932 domain-containing protein -
HGK25_RS27365 (HGK25_27910) 78859..80067 + 1209 WP_015344990 IS256 family transposase -
HGK25_RS27370 (HGK25_27920) 80203..80616 - 414 WP_013023817 helix-turn-helix domain-containing protein -
HGK25_RS27375 (HGK25_27925) 80617..80895 - 279 WP_196542349 helix-turn-helix transcriptional regulator -
HGK25_RS27380 (HGK25_27930) 80885..81203 - 319 Protein_91 type II toxin-antitoxin system RelE/ParE family toxin -
HGK25_RS27385 (HGK25_27935) 81284..81508 - 225 WP_004152719 hypothetical protein -
HGK25_RS27390 (HGK25_27940) 81519..81731 - 213 WP_013023815 hypothetical protein -


Host bacterium


ID   5879 GenBank   NZ_CP051492
Plasmid name   pM297-1.2 Incompatibility group   IncFII
Plasmid size   225763 bp Coordinate of oriT [Strand]   76234..76282 [+]; 216997..217045 [+]
Host baterium   Klebsiella pneumoniae strain M297-1

Cargo genes


Drug resistance gene   blaCTX-M-14, blaLAP-2, sul2, aph(3'')-Ib, aph(6)-Id, aph(3')-Ia, aac(3)-IId, floR, tet(A), mph(A), sul1, qnrB91, qacE, aadA16, dfrA27, ARR-3, aac(6')-Ib-cr, blaTEM-1B, blaCTX-M-3, qnrS1
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9