Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105415
Name   oriT_p20723-3 in_silico
Organism   Salmonella enterica subsp. enterica serovar Uganda strain CVM 20723
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP051424 (44166..44218 [+], 53 nt)
oriT length   53 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 53 nt

>oriT_p20723-3
CACACGATTGTAACATGACCGGAACGGTCTTGTGTACAATCGGTATCGTGCCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3677 GenBank   WP_000338972
Name   t4cp2_HFQ25_RS00725_p20723-3 insolico UniProt ID   _
Length   652 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 652 a.a.        Molecular weight: 73329.86 Da        Isoelectric Point: 9.1391

>WP_000338972.1 MULTISPECIES: type IV secretory system conjugative DNA transfer family protein [Enterobacteriaceae]
MDAKKTGGLILFLLLLLVGVLIASNYLGGYTALRYSSVDISLLKWDTFHSVISTFSGNPQYKKLVFMAWF
GFSVPLIFFAIFMLIVVIGIMPKKVIYGDARLATDMDLSKSGFFPDKKSPYKHPPILIGKMFKGRYKKQF
IYFAGQQFLILYAPTRSGKGVGIVIPNCVNYPGSMVILDIKLENWFLSAGFRQKELGQECFLFAPAGYAE
TIDQAIKGQIRSHRWNPLDCVSRSDLLRETDLAKIAAILIPASDDPIWSDSARNLFVGLGLYLLDKERFH
LEQKAKGHNVPDVLVSISAILKTSVPDGGKDLAAWMGQEIENRSWISDKTKSFFFKFMSAPDRTRGSIET
NFSSPLSIFSNPITAEATNFSDFDIRDIRKKPMSIYLGLTPDALITHEKIVNLFFSLLVNENCRELPEHN
PDLKYQCLILLDEFTSMGKSEVIERAVGFTAGYNLRFMFILQNEGQGQKSDMYGQEGWTTFTENSAVVLY
YPPKSKNALAKKISEEIGVRDMKISKRSISSGGGKGGSSRTRNDDVIERPVLLPEEIVSLRDKKNKARNI
AIREIITSEFSRPFIANKIIWFEEPEFKRRVDIARNNHVDIPNLFTQEVMDEIAKIAEIYLPKAGGKKVM
VAGGNVITNPDLDNHDKTDVSE

  Protein domains


Predicted by InterproScan.

(127-591)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 5275..28272

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HFQ25_RS00590 (HFQ25_00600) 767..1219 + 453 WP_000101552 CaiF/GrlA family transcriptional regulator -
HFQ25_RS00595 (HFQ25_00605) 1212..1406 + 195 WP_001127358 DUF1187 family protein -
HFQ25_RS00600 (HFQ25_00610) 1452..2405 + 954 WP_072097371 SPFH domain-containing protein -
HFQ25_RS00605 (HFQ25_00615) 2467..2910 + 444 WP_000498521 NfeD family protein -
HFQ25_RS00610 (HFQ25_00620) 2914..3084 + 171 WP_000550721 hypothetical protein -
HFQ25_RS00615 (HFQ25_00625) 3095..3757 + 663 WP_001243159 hypothetical protein -
HFQ25_RS00620 (HFQ25_00630) 3908..4501 + 594 WP_001243171 hypothetical protein -
HFQ25_RS00625 (HFQ25_00635) 4715..5017 + 303 WP_000189499 hypothetical protein -
HFQ25_RS00630 (HFQ25_00640) 5014..5271 + 258 WP_000739144 hypothetical protein -
HFQ25_RS00635 (HFQ25_00645) 5275..6270 + 996 WP_000276068 type IV secretion system protein virB6
HFQ25_RS00640 (HFQ25_00650) 6276..6917 + 642 WP_001415805 type IV secretion system protein -
HFQ25_RS00645 (HFQ25_00655) 6920..7174 + 255 WP_000609210 EexN family lipoprotein -
HFQ25_RS00650 (HFQ25_00660) 7227..8036 - 810 WP_001005154 DUF5710 domain-containing protein -
HFQ25_RS00655 (HFQ25_00665) 8084..8719 + 636 WP_000835769 hypothetical protein -
HFQ25_RS00660 (HFQ25_00675) 8891..9178 + 288 WP_001326593 TrbM/KikA/MpfK family conjugal transfer protein -
HFQ25_RS00665 (HFQ25_00680) 9181..10416 + 1236 WP_000733393 toxin co-regulated pilus biosynthesis Q family protein -
HFQ25_RS00670 (HFQ25_00685) 10422..10859 + 438 WP_000539665 type IV pilus biogenesis protein PilM -
HFQ25_RS00675 (HFQ25_00690) 10978..11376 + 399 WP_001153669 hypothetical protein -
HFQ25_RS00680 (HFQ25_00695) 11397..11981 + 585 WP_001177114 lytic transglycosylase domain-containing protein virB1
HFQ25_RS00685 11981..12271 + 291 WP_000865478 TrbC/VirB2 family protein virB2
HFQ25_RS00690 (HFQ25_00705) 12342..12662 + 321 WP_000362083 VirB3 family type IV secretion system protein virB3
HFQ25_RS00695 (HFQ25_00710) 12668..15025 + 2358 WP_000548951 VirB4 family type IV secretion system protein virb4
HFQ25_RS00700 (HFQ25_00715) 15057..15191 + 135 WP_000701233 hypothetical protein -
HFQ25_RS00705 (HFQ25_00720) 15191..15925 + 735 WP_000432283 type IV secretion system protein virB8
HFQ25_RS00710 (HFQ25_00725) 15991..16692 + 702 WP_000274524 TrbG/VirB9 family P-type conjugative transfer protein -
HFQ25_RS00715 (HFQ25_00730) 16682..17821 + 1140 WP_000790639 TrbI/VirB10 family protein virB10
HFQ25_RS00720 (HFQ25_00735) 17896..18951 + 1056 WP_001059977 P-type DNA transfer ATPase VirB11 virB11
HFQ25_RS00725 (HFQ25_00740) 18967..20925 + 1959 WP_000338972 type IV secretory system conjugative DNA transfer family protein -
HFQ25_RS00730 (HFQ25_00745) 20976..22619 + 1644 WP_001035589 PilN family type IVB pilus formation outer membrane protein -
HFQ25_RS00735 (HFQ25_00750) 22670..23980 + 1311 WP_001454111 type 4b pilus protein PilO2 -
HFQ25_RS00740 (HFQ25_00755) 23964..24458 + 495 WP_000912554 type IV pilus biogenesis protein PilP -
HFQ25_RS00745 (HFQ25_00760) 24483..26021 + 1539 WP_000466225 ATPase, T2SS/T4P/T4SS family virB11
HFQ25_RS00750 (HFQ25_00765) 26012..27121 + 1110 WP_000974903 type II secretion system F family protein -
HFQ25_RS00755 (HFQ25_00770) 27166..27723 + 558 WP_000095048 type 4 pilus major pilin -
HFQ25_RS00760 (HFQ25_00775) 27790..28272 + 483 WP_001258095 lytic transglycosylase domain-containing protein virB1
HFQ25_RS00765 (HFQ25_00780) 28276..28911 + 636 WP_000934978 A24 family peptidase -
HFQ25_RS00770 (HFQ25_00785) 28924..30300 + 1377 WP_000750519 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HFQ25_RS25130 30297..30518 - 222 Protein_37 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HFQ25_RS00780 (HFQ25_00790) 30581..31705 + 1125 WP_000486720 site-specific integrase -
HFQ25_RS00785 (HFQ25_00795) 31717..32370 + 654 WP_000572549 hypothetical protein -
HFQ25_RS00790 (HFQ25_00800) 32400..32935 + 536 Protein_40 thermonuclease family protein -


Host bacterium


ID   5853 GenBank   NZ_CP051424
Plasmid name   p20723-3 Incompatibility group   IncI2
Plasmid size   57420 bp Coordinate of oriT [Strand]   44166..44218 [+]
Host baterium   Salmonella enterica subsp. enterica serovar Uganda strain CVM 20723

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -