Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105372
Name   oriT_p35161-2 in_silico
Organism   Salmonella enterica subsp. enterica serovar Heidelberg strain CVM 35161
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP051312 (101023..101111 [-], 89 nt)
oriT length   89 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 89 nt

>oriT_p35161-2
GGGGTGTCGGGGCGAAGCCCTGACCAGATGGTAATTGTAATAGCGTCGCGTGTGACGGTATTACAATTACACATCCTGTCCCGTTTTTC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein


ID   1655 GenBank   WP_001283947
Name   WP_001283947_p35161-2 insolico UniProt ID   A0A142CMC2
Length   110 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 110 a.a.        Molecular weight: 12613.57 Da        Isoelectric Point: 10.7463

>WP_001283947.1 MULTISPECIES: IncI1-type relaxosome accessory protein NikA [Enterobacteriaceae]
MSDSAVRKKSEVRQKTVVRTLRFSPVEDETIRKKAEDSGLTVSAYIRNAALNKRINSRTDDAFLKELMRL
GRMQKHLFVQGKRTGDKEYAEVLVAITELTNTLRKQLMEG

  Protein domains



No domain identified.



  Protein structure


Source ID Structure
AlphaFold DB A0A142CMC2


T4CP


ID   3640 GenBank   WP_001289271
Name   trbC_HFU19_RS24790_p35161-2 insolico UniProt ID   _
Length   763 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 763 a.a.        Molecular weight: 86927.12 Da        Isoelectric Point: 6.7713

>WP_001289271.1 MULTISPECIES: F-type conjugative transfer protein TrbC [Enterobacteriaceae]
MSEHRVNPELLHRTAWGNPVWNALQSLNIYGFCLVASLVASFIWPLALPACLLFTLITMLVFSLQRWRCP
LRMPMTLECADPSQDRMIKRSLFSFWPTLFQYEVILESPASGIFYVGYQRVRDIGRELWLSMDDLTRHIM
FFATTGGGKTETIFAWAINPLCWARGFTLVDGKAQNDTARTIWYLARRFGREDDVEVINFMNGGKSRSEI
ILSGEKTRPQSNTWNPFCYSTEAFTAETMQSMLPQNVQGGEWQSRAIAMNKALVFGTKFWCVREGKTMSL
QMLREHMTLEGMAKLYCRGLDDQWPEEAIAPLRNYLQDVPGFDLSLVRTPSAWTEEPRKQHAYLSGQFSE
TFSTFTEAFGDIFAEDSGDIDIRDSIHSDRILMVMIPALDTSAHTTSALGRMFITQKSMILARDLGYRLE
GTDSDALEVKKYKGRFPYLCFLDEVGAYYTDRIAVEATQVRSLDFALILMAQDQERIEGQTTATNTATLM
QNTGTKFAGRIVSEGSTARTLKSAAGEEARARMNNLQRQDGIFGESWIDSPQISILMESKIDVQELIELH
PGEFFSIFRGETVPSASFFIPDNEKSCSSDPVVINRYISVDAPRLDRLRRLVPRTAQRRIPSPENVSAII
GVLTAKPSRKRRKIRTEPHTIVDTFQQRIAGRQAAMAMLEEYDTDINARESALWETAVNTLKTTTREERR
IRYITLNRPELPETKEENQISVRAERAGINLLTLPQDNNHLTGRPVNGFHHKKTNRPDWDGMY

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 5021..44725

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HFU19_RS24790 (HFU19_24805) 2737..5028 - 2292 WP_001289271 F-type conjugative transfer protein TrbC -
HFU19_RS24795 (HFU19_24810) 5021..6091 - 1071 WP_000151575 IncI1-type conjugal transfer protein TrbB trbB
HFU19_RS24800 (HFU19_24815) 6110..7318 - 1209 WP_000121273 IncI1-type conjugal transfer protein TrbA trbA
HFU19_RS24805 (HFU19_24820) 7610..7762 + 153 WP_001303307 Hok/Gef family protein -
HFU19_RS24810 (HFU19_24825) 7834..8085 - 252 WP_001291965 hypothetical protein -
HFU19_RS24815 (HFU19_24830) 8446..9228 - 783 WP_001300609 IS21-like element IS100kyp family helper ATPase IstB -
HFU19_RS24820 (HFU19_24835) 9225..10247 - 1023 WP_001572805 IS21-like element IS100 family transposase -
HFU19_RS24825 (HFU19_24840) 10968..11144 - 177 WP_001054900 hypothetical protein -
HFU19_RS24830 (HFU19_24845) 11536..11745 + 210 WP_000062603 HEAT repeat domain-containing protein -
HFU19_RS24835 (HFU19_24850) 11817..12479 - 663 WP_000644794 plasmid IncI1-type surface exclusion protein ExcA -
HFU19_RS24840 (HFU19_24855) 12550..14718 - 2169 WP_000698368 DotA/TraY family protein traY
HFU19_RS24845 (HFU19_24860) 14815..15399 - 585 WP_001037998 conjugal transfer protein TraX -
HFU19_RS24850 (HFU19_24865) 15428..16630 - 1203 WP_001189158 IncI1-type conjugal transfer protein TraW traW
HFU19_RS24855 (HFU19_24870) 16597..17211 - 615 WP_000337394 IncI1-type conjugal transfer protein TraV traV
HFU19_RS24860 (HFU19_24875) 17211..20255 - 3045 WP_001024751 IncI1-type conjugal transfer protein TraU traU
HFU19_RS24865 (HFU19_24880) 20345..21145 - 801 WP_001164788 IncI1-type conjugal transfer protein TraT traT
HFU19_RS24870 (HFU19_24885) 21129..21317 - 189 WP_001277255 putative conjugal transfer protein TraS -
HFU19_RS24875 (HFU19_24890) 21381..21785 - 405 WP_000086960 IncI1-type conjugal transfer protein TraR traR
HFU19_RS24880 (HFU19_24895) 21836..22363 - 528 WP_001055569 conjugal transfer protein TraQ traQ
HFU19_RS24885 (HFU19_24900) 22363..23067 - 705 WP_000801920 IncI1-type conjugal transfer protein TraP traP
HFU19_RS24890 (HFU19_24905) 23067..24356 - 1290 WP_001271997 conjugal transfer protein TraO traO
HFU19_RS24895 (HFU19_24910) 24359..25342 - 984 WP_001191878 IncI1-type conjugal transfer protein TraN traN
HFU19_RS24900 (HFU19_24915) 25353..26045 - 693 WP_000138552 DotI/IcmL family type IV secretion protein traM
HFU19_RS24905 (HFU19_24920) 26042..26389 - 348 WP_001055900 conjugal transfer protein traL
HFU19_RS24910 (HFU19_24925) 26407..30174 - 3768 WP_001141535 LPD7 domain-containing protein -
HFU19_RS24915 (HFU19_24930) 30264..30815 - 552 WP_000014584 phospholipase D family protein -
HFU19_RS24920 (HFU19_24935) 30830..31120 - 291 WP_001299214 hypothetical protein traK
HFU19_RS24925 (HFU19_24940) 31117..32265 - 1149 WP_001024972 plasmid transfer ATPase TraJ virB11
HFU19_RS24930 (HFU19_24945) 32262..33080 - 819 WP_000646097 IncI1-type conjugal transfer lipoprotein TraI traI
HFU19_RS24935 (HFU19_24950) 33077..33535 - 459 WP_001079808 IncI1-type conjugal transfer lipoprotein TraH -
HFU19_RS24940 (HFU19_24955) 33930..34514 - 585 WP_000977517 histidine phosphatase family protein -
HFU19_RS24945 (HFU19_24960) 34574..35776 - 1203 WP_000976353 conjugal transfer protein TraF -
HFU19_RS24950 (HFU19_24965) 35862..36686 - 825 WP_001238927 conjugal transfer protein TraE traE
HFU19_RS24955 (HFU19_24970) 36837..37991 - 1155 WP_001139958 site-specific integrase -
HFU19_RS24960 (HFU19_24975) 38682..38930 + 249 WP_001349157 hypothetical protein -
HFU19_RS24965 (HFU19_24980) 38927..40219 - 1293 WP_032274560 shufflon system plasmid conjugative transfer pilus tip adhesin PilV -
HFU19_RS24970 (HFU19_24985) 40219..40875 - 657 WP_001193553 prepilin peptidase -
HFU19_RS24975 (HFU19_24990) 40860..41420 - 561 WP_000014116 lytic transglycosylase domain-containing protein virB1
HFU19_RS24980 (HFU19_24995) 41430..42044 - 615 WP_000959785 type 4 pilus major pilin -
HFU19_RS24985 (HFU19_25000) 42062..43159 - 1098 WP_001208805 type II secretion system F family protein -
HFU19_RS24990 (HFU19_25005) 43172..44725 - 1554 WP_000362202 ATPase, T2SS/T4P/T4SS family virB11
HFU19_RS24995 (HFU19_25010) 44736..45188 - 453 WP_001247336 type IV pilus biogenesis protein PilP -
HFU19_RS25000 (HFU19_25015) 45175..46470 - 1296 WP_000752774 type 4b pilus protein PilO2 -
HFU19_RS25005 (HFU19_25020) 46463..48145 - 1683 WP_000748143 PilN family type IVB pilus formation outer membrane protein -
HFU19_RS25010 (HFU19_25025) 48159..48596 - 438 WP_000539807 type IV pilus biogenesis protein PilM -
HFU19_RS25015 (HFU19_25030) 48596..49663 - 1068 WP_000742600 type IV pilus biogenesis lipoprotein PilL -


Host bacterium


ID   5810 GenBank   NZ_CP051312
Plasmid name   p35161-2 Incompatibility group   IncI1
Plasmid size   101468 bp Coordinate of oriT [Strand]   101023..101111 [-]
Host baterium   Salmonella enterica subsp. enterica serovar Heidelberg strain CVM 35161

Cargo genes


Drug resistance gene   blaCMY-2
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -