Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105341
Name   oriT_pBs162S2c in_silico
Organism   Bradyrhizobium septentrionale strain 162S2
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP088291 (9113..9168 [-], 56 nt)
oriT length   56 nt
IRs (inverted repeats)      23..29, 34..40  (ACGTCGC..GCGACGT)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 56 nt

>oriT_pBs162S2c
CCCCGGCAGGCGGGAAAACAGGACGTCGCGGATGCGACGTATTACTGCGCCCTTGG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


T4CP


ID   3615 GenBank   WP_176540777
Name   t4cp2_HU675_RS50700_pBs162S2c insolico UniProt ID   _
Length   817 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 817 a.a.        Molecular weight: 91346.76 Da        Isoelectric Point: 6.3242

>WP_176540777.1 conjugal transfer protein TrbE [Bradyrhizobium septentrionale]
MVALHSFRHSGPSFADLVPYAGLVDDGIVLLKDGSLMAGWYFAGPDSESSTDAERNDVSRQINAILARLG
SGWMIQVEALRIPTTDYPARKDGHFPDAVTREIDEERRAHFERESGHYESRHALILSWRPPERRKSGLAK
YVYSDKDSRSASFADTALGNFRASVREIEQYLSNLLSIQRMRTRTVEERGGSRSARYDELFQFVRFCITG
ENHPVRLPEVPMYLDWLVTAEYQHGLTPTVDGRYVGVVAIDGLPAESWPGILNVLDQMPLTYRWSSRFMF
LDEIEARERLERTRKKWQQKVRPFFDQLFQTQSRSIDQDAMAMVAETQDAIAEAASQLVAYGYYTPVIVL
QDHDADRLREKCEGIRRVVQAEGFGARIETLNATEAFLGSLPGNWYANIREPLIHTRNLADLLPLNSVWS
GSPVAPCPFYPESSPPLMQVASGSTPFRLNLHTDDVGHSLIFGPTGSGKSTLLALIAAQFRRYRDAQIFA
FDKGRSLMPLTLAAGGDHYEIGGGAGEGLQLAFCPLAELATDADRAWASEWIETLVVLQGVSVTPDHRNA
ISRQVTLMAAAPGRSLADFVSGVQMREIKDALHHYTVDGPMGHLLDAERDGLTLGGFQTFEIEELMNMGE
RSLVPVLTYLFRRIEKRLTGAPSLILLDEAWLMLGHPVFRDKIREWLKVLRKANCAVVLATQSISDAERS
GIIDVLKESCPTKICLPNGAAREPGTREFYERLGFNERQVEIVSNAIPKREYYVTSPAGRRLFEMALGPV
ALAFVGASGRDDLKRITELKTAHGRTWPANWLQTRGIAHADTLLAHD

  Protein domains


Predicted by InterproScan.

(188-400)

  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 103083..112454

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HU675_RS50645 (HU675_0050645) 98556..99572 - 1017 WP_225024896 integrase core domain-containing protein -
HU675_RS50650 (HU675_0050650) 100066..101400 + 1335 WP_176540782 IS1182 family transposase -
HU675_RS50655 (HU675_0050655) 101453..101611 + 159 Protein_84 IS256 family transposase -
HU675_RS50660 (HU675_0050660) 101590..101823 - 234 Protein_85 hypothetical protein -
HU675_RS50665 (HU675_0050665) 101901..102611 - 711 WP_166107311 autoinducer binding domain-containing protein -
HU675_RS50670 (HU675_0050670) 103083..104378 - 1296 WP_166107234 IncP-type conjugal transfer protein TrbI virB10
HU675_RS50675 (HU675_0050675) 104392..104856 - 465 WP_166107236 conjugal transfer protein TrbH -
HU675_RS50680 (HU675_0050680) 104861..105685 - 825 WP_166107238 P-type conjugative transfer protein TrbG virB9
HU675_RS50685 (HU675_0050685) 105703..106365 - 663 WP_176540780 conjugal transfer protein TrbF virB8
HU675_RS50690 (HU675_0050690) 106381..107568 - 1188 WP_176540779 P-type conjugative transfer protein TrbL virB6
HU675_RS50695 (HU675_0050695) 107562..108380 - 819 WP_176540778 P-type conjugative transfer protein TrbJ virB5
HU675_RS50700 (HU675_0050700) 108352..110805 - 2454 WP_176540777 conjugal transfer protein TrbE virb4
HU675_RS50705 (HU675_0050705) 110815..111114 - 300 WP_176540776 conjugal transfer protein TrbD virB3
HU675_RS50710 (HU675_0050710) 111107..111496 - 390 WP_166218034 TrbC/VirB2 family protein virB2
HU675_RS50715 (HU675_0050715) 111486..112454 - 969 WP_176540775 P-type conjugative transfer ATPase TrbB virB11
HU675_RS50720 (HU675_0050720) 112451..113086 - 636 WP_176540774 acyl-homoserine-lactone synthase -
HU675_RS50725 (HU675_0050725) 113447..114682 + 1236 WP_175618600 plasmid partitioning protein RepA -
HU675_RS50730 (HU675_0050730) 114858..115871 + 1014 WP_176540773 plasmid partitioning protein RepB -
HU675_RS50735 (HU675_0050735) 116087..117406 + 1320 WP_176540772 plasmid replication protein RepC -


Host bacterium


ID   5779 GenBank   NZ_CP088291
Plasmid name   pBs162S2c Incompatibility group   -
Plasmid size   177103 bp Coordinate of oriT [Strand]   9113..9168 [-]
Host baterium   Bradyrhizobium septentrionale strain 162S2

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -