Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105334
Name   oriT_CriePir75|unnamed3 in_silico
Organism   Klebsiella pneumoniae strain CriePir75
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP063022 (1049..1108 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_CriePir75|unnamed3
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3640 GenBank   WP_193699470
Name   Relaxase_GJJ10_RS27620_CriePir75|unnamed3 insolico UniProt ID   _
Length   211 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 211 a.a.        Molecular weight: 23368.54 Da        Isoelectric Point: 7.3183

>WP_193699470.1 relaxase/mobilization nuclease domain-containing protein, partial [Klebsiella pneumoniae]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYVKKYTSGVLSFAEADLPPGQR
EKLMASFERVLMPGLDKDQYSILWVEHADKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTVVN
GRLGLHDPNDPENRRALVTPSGLPETKQEAAETITRGLLMLASSGELKTRDDVTGALTAAGFEVVRTTKN
S

  Protein domains


Predicted by InterproScan.

(57-209)


  Protein structure



No available structure.




Auxiliary protein


ID   1638 GenBank   WP_071599364
Name   WP_071599364_CriePir75|unnamed3 insolico UniProt ID   A0A9Q5XKH5
Length   113 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 113 a.a.        Molecular weight: 12571.54 Da        Isoelectric Point: 8.8015

>WP_071599364.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacterales]
MADKRNKMLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPTRAGRLPSISPALLRQLAGMGNNLNQI
ARKVNAGGAGHDRVQIVAALMAIDAGLERLRHAVLEKGPDDDC

  Protein domains


Predicted by InterproScan.

(57-100)


  Protein structure



No available structure.




Host bacterium


ID   5772 GenBank   NZ_CP063022
Plasmid name   CriePir75|unnamed3 Incompatibility group   Col440II
Plasmid size   3511 bp Coordinate of oriT [Strand]   1049..1108 [+]
Host baterium   Klebsiella pneumoniae strain CriePir75

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -