Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105324
Name   oriT_RHBSTW-00268|unnamed in_silico
Organism   Klebsiella quasipneumoniae strain RHBSTW-00268
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055343 (1445..1502 [-], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_RHBSTW-00268|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3635 GenBank   WP_149643728
Name   Relaxase_HV140_RS27625_RHBSTW-00268|unnamed insolico UniProt ID   _
Length   205 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 205 a.a.        Molecular weight: 22675.71 Da        Isoelectric Point: 6.7396

>WP_149643728.1 MULTISPECIES: relaxase/mobilization nuclease domain-containing protein, partial [Enterobacteriaceae]
MIVKFHPRGRGGGGGPVDYLLGKDRQRDGASVLQGKPDEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHRDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRVLVSPSALPEAKQEAAQAITSGLLALASSGELKTRQDVTEALESAGFEVV

  Protein domains


Predicted by InterproScan.

(57-204)


  Protein structure



No available structure.




Auxiliary protein


ID   1635 GenBank   WP_004193914
Name   WP_004193914_RHBSTW-00268|unnamed insolico UniProt ID   A0A8T3UXZ2
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11783.55 Da        Isoelectric Point: 7.8963

>WP_004193914.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCEGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQIVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   5762 GenBank   NZ_CP055343
Plasmid name   RHBSTW-00268|unnamed Incompatibility group   ColRNAI
Plasmid size   2542 bp Coordinate of oriT [Strand]   1445..1502 [-]
Host baterium   Klebsiella quasipneumoniae strain RHBSTW-00268

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -