Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105321
Name   oriT_RHBSTW-00268|unnamed in_silico
Organism   Klebsiella quasipneumoniae strain RHBSTW-00268
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055338 (1041..1100 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_RHBSTW-00268|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3634 GenBank   WP_181479949
Name   Relaxase_HV140_RS27525_RHBSTW-00268|unnamed insolico UniProt ID   _
Length   205 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 205 a.a.        Molecular weight: 22774.89 Da        Isoelectric Point: 7.3180

>WP_181479949.1 relaxase/mobilization nuclease domain-containing protein, partial [Klebsiella quasipneumoniae]
MIVKFHPRGRGGGAGPVDYLLGKDRQRDGATVLQGKPEEVRELIDASPYAKKYTSGVLSFAEKDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSALPETKQEAAQAITRGLLALASSGELKTRQDVTEALESAGFEVV

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(56-204)


  Protein structure



No available structure.




Auxiliary protein

ID   1634 GenBank   WP_171944688
Name   WP_171944688_RHBSTW-00268|unnamed insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11754.51 Da        Isoelectric Point: 8.5693

>WP_171944688.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTEDEHRRLLERCNGKQLAAWMRQTCLDEKPARAGKLPSLSPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQVVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.




Host bacterium

ID   5759 GenBank   NZ_CP055338
Plasmid name   RHBSTW-00268|unnamed Incompatibility group   Col440II
Plasmid size   3944 bp Coordinate of oriT [Strand]   1041..1100 [+]
Host baterium   Klebsiella quasipneumoniae strain RHBSTW-00268

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -