Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105320
Name   oriT_RHBSTW-00268|unnamed in_silico
Organism   Klebsiella quasipneumoniae strain RHBSTW-00268
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055337 (3140..3199 [-], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_RHBSTW-00268|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3633 GenBank   WP_181479946
Name   Relaxase_HV140_RS27520_RHBSTW-00268|unnamed insolico UniProt ID   _
Length   230 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 230 a.a.        Molecular weight: 25504.99 Da        Isoelectric Point: 9.1731

>WP_181479946.1 relaxase/mobilization nuclease domain-containing protein, partial [Klebsiella quasipneumoniae]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSALPEMKQEAAQAITRGLLALASSGELKTRQDVTEALESAGFEVVRTTKS
SISIADPDGGRNIRLKGAIY

  Protein domains


Predicted by InterproScan.

(56-218)


  Protein structure



No available structure.




Auxiliary protein


ID   1633 GenBank   WP_181479948
Name   WP_181479948_RHBSTW-00268|unnamed insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11718.43 Da        Isoelectric Point: 7.8686

>WP_181479948.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSLSPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQVVAALMAIDAGLERLRNAVLEKGGDDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   5758 GenBank   NZ_CP055337
Plasmid name   RHBSTW-00268|unnamed Incompatibility group   Col440I
Plasmid size   4316 bp Coordinate of oriT [Strand]   3140..3199 [-]
Host baterium   Klebsiella quasipneumoniae strain RHBSTW-00268

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -