Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105233
Name   oriT_pRHBSTW-00634_4 in_silico
Organism   Klebsiella grimontii strain RHBSTW-00634
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP056685 (82172..82220 [-], 49 nt)
oriT length   49 nt
IRs (inverted repeats)      6..13, 16..23  (GCAAAATT..AATTTTGC)
Location of nic site      32..33
Conserved sequence flanking the
  nic site    		  GGTGTGGTGA
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 49 nt

>oriT_pRHBSTW-00634_4
AATCTGCAAAATTTTAATTTTGCGTGGGGTGTGGTGATTTTGTGGTGAG

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Auxiliary protein

ID   1610 GenBank   WP_020805752
Name   WP_020805752_pRHBSTW-00634_4 insolico UniProt ID   A0A377TIM3
Length   130 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 130 a.a.        Molecular weight: 14772.81 Da        Isoelectric Point: 4.5715

>WP_020805752.1 MULTISPECIES: conjugal transfer relaxosome DNA-binding protein TraM [Gammaproteobacteria]
MAKIQVYVNDNVAEKINAIAVQRRAEGAKEKDISYSSIASMLLELGLRVYEAQMERKESGFNQMAFNRAL
LESMVKTQFTVNKVLGIECLSPHVNGNPKWEWSGLIENIRDDVSAVMEKFFPNESEIEDE

  Protein domains


Predicted by InterproScan.

TraM protein, DNA-binding (Tra_M)

(1-125)


  Protein structure


Source ID Structure
AlphaFold DB A0A377TIM3


T4CP

ID   3555 GenBank   WP_070612648
Name   traD_HV252_RS30675_pRHBSTW-00634_4 insolico UniProt ID   _
Length   766 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 766 a.a.        Molecular weight: 85307.12 Da        Isoelectric Point: 4.9615

>WP_070612648.1 MULTISPECIES: type IV conjugative transfer system coupling protein TraD [Klebsiella]
MSFNAKDMTQGGQIANMRFRMFGQIANIIFYVLFILFWVLCGLMLMYRLSWQTFVNGCVYWWCTTLGPMR
DIIRSQPVYTIQYYGQSLEYTSEQILADKYTIWCGEQLWTGFAFAAVVSLVICIVTFFIASWVLGRQGKQ
QSEDENTGGRQLSDKPKEVARQMKRDGVASDIKIGDLPILKNSEIQNFCLHGTVGSGKSEVIRRLLNYVR
ARGDMAIIYDRSCEFVKSYYDPSLDKILNPLDSRCAAWDLWKECLTLPDFDNISNTLIPMGTKEDPFWQG
SGRTIFAEGAYLMREDDDRSYEKLVDTMLSIKIDKLRAYLQNTPAANLVEEKIEKTAISIRAVLTNYVKA
IRYLQGIEKNGEPFTIRDWMRGVREDRPNGWLFISSNADTHASLKPVISMWLSIAIRGLLAMGENRNRRV
WIFADELPTLHKLPDLVEILPEARKFGGCYVFGIQSYAQLEDIYGVKPAATLFDVMNTRAFFRSPSKEIA
EFAAGEIGEKEILKASEQYSYGADPVRDGVSTGKEKERETLVSYSDIQTLPDLSCYVTLPGPYPAVKLAL
KYKPRPKIAEGFIPRTLDARVDARLSALLEAREAEGSLARALFTPDAPASGPDDAGSHAGERPELASQPA
PAEVTVSPAPVKAPATTTMPAAEPSARTAEPPVLRVTAVPLIKPKAAAAASTASSAGNPAAAAGGTEQEL
AQQSAEQGQDMLPAGMNEDGVIEDMQAYDAWADEQTQRDMQRREEVNINHSHRHDEQDDVEIGGNF

  Protein domains


Predicted by InterproScan.

F sex factor protein N terminal (TraD_N)

(32-128)

Type IV secretion-system coupling protein DNA-binding domain (TrwB_AAD_bind)

(172-560)

  Protein structure



No available structure.




T4SS

T4SS were predicted by using oriTfinder2.

Region 1: 99490..117686

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HV252_RS30565 (HV252_30575) 96252..97256 + 1005 WP_000427623 IS110-like element IS4321 family transposase -
HV252_RS30570 (HV252_30580) 97524..97988 + 465 Protein_112 Tn3 family transposase -
HV252_RS30575 (HV252_30585) 98022..99101 + 1080 Protein_113 type IV secretion system protein TraC -
HV252_RS30580 (HV252_30590) 99101..99490 + 390 WP_042939105 type-F conjugative transfer system protein TrbI -
HV252_RS30585 (HV252_30595) 99490..100116 + 627 WP_070612662 type-F conjugative transfer system protein TraW traW
HV252_RS30590 (HV252_30600) 100160..101119 + 960 WP_029497356 conjugal transfer pilus assembly protein TraU traU
HV252_RS30595 (HV252_30605) 101134..101682 + 549 WP_022631518 hypothetical protein -
HV252_RS30600 (HV252_30610) 102403..103005 + 603 WP_181511916 hypothetical protein -
HV252_RS30605 (HV252_30615) 103150..103797 + 648 WP_153650534 type-F conjugative transfer system pilin assembly protein TrbC trbC
HV252_RS30610 (HV252_30620) 103856..105811 + 1956 WP_020803160 type-F conjugative transfer system mating-pair stabilization protein TraN traN
HV252_RS30615 (HV252_30625) 105844..106125 + 282 WP_022644736 hypothetical protein -
HV252_RS30620 (HV252_30630) 106115..106342 + 228 WP_012540032 conjugal transfer protein TrbE -
HV252_RS30625 (HV252_30635) 106353..106679 + 327 WP_020323521 hypothetical protein -
HV252_RS30630 (HV252_30640) 106700..107452 + 753 WP_004152677 type-F conjugative transfer system pilin assembly protein TraF traF
HV252_RS30635 (HV252_30645) 107463..107702 + 240 WP_023340931 type-F conjugative transfer system pilin chaperone TraQ -
HV252_RS30640 (HV252_30650) 107674..108231 + 558 WP_032433944 type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB traF
HV252_RS30645 (HV252_30655) 108277..108720 + 444 WP_153650532 F-type conjugal transfer protein TrbF -
HV252_RS30650 (HV252_30660) 108698..110077 + 1380 WP_072198238 conjugal transfer pilus assembly protein TraH traH
HV252_RS30655 (HV252_30665) 110077..112920 + 2844 WP_070612650 conjugal transfer mating-pair stabilization protein TraG traG
HV252_RS30660 (HV252_30670) 112923..113453 + 531 WP_077270072 conjugal transfer protein TraS -
HV252_RS30665 (HV252_30675) 113644..114375 + 732 WP_004152629 conjugal transfer complement resistance protein TraT -
HV252_RS30670 (HV252_30680) 114568..115260 + 693 WP_172971311 hypothetical protein -
HV252_RS30675 (HV252_30685) 115386..117686 + 2301 WP_070612648 type IV conjugative transfer system coupling protein TraD virb4

Host bacterium

ID   5671 GenBank   NZ_CP056685
Plasmid name   pRHBSTW-00634_4 Incompatibility group   IncFIA
Plasmid size   128344 bp Coordinate of oriT [Strand]   82172..82220 [-]
Host baterium   Klebsiella grimontii strain RHBSTW-00634

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   AcrIE9