Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105212
Name   oriT_RHBSTW-00269|unnamed in_silico
Organism   Citrobacter freundii strain RHBSTW-00269
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055549 (1065..1122 [+], 58 nt)
oriT length   58 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 58 nt

>oriT_RHBSTW-00269|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCT

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3589 GenBank   WP_181499711
Name   Relaxase_HV141_RS26470_RHBSTW-00269|unnamed insolico UniProt ID   _
Length   213 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 213 a.a.        Molecular weight: 23536.68 Da        Isoelectric Point: 8.3767

>WP_181499711.1 relaxase/mobilization nuclease domain-containing protein, partial [Citrobacter freundii]
MIVKFHPRGRGGGGGPVDYLLGKDRQRDGASVLQGKPDEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHRDKGRLELNFLIPNTELLTGKRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRVLVSPSALPEAKQEAAQAITSGLLALASSGELKTRQDVTEALESAGFEVVRTTKS
SIS

  Protein domains


Predicted by InterproScan.

(57-211)


  Protein structure



No available structure.




Auxiliary protein


ID   1604 GenBank   WP_004193914
Name   WP_004193914_RHBSTW-00269|unnamed insolico UniProt ID   A0A8T3UXZ2
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11783.55 Da        Isoelectric Point: 7.8963

>WP_004193914.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Bacteria]
MLTMWVTEDEHRRLLERCEGKQLAAWMRQTCLDEKPARAGKLPSISPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQIVAALMAIDAGLERLRHAVLEKGADDDR

  Protein domains


Predicted by InterproScan.

(50-94)


  Protein structure



No available structure.




Host bacterium


ID   5650 GenBank   NZ_CP055549
Plasmid name   RHBSTW-00269|unnamed Incompatibility group   Col440II
Plasmid size   2566 bp Coordinate of oriT [Strand]   1065..1122 [+]
Host baterium   Citrobacter freundii strain RHBSTW-00269

Cargo genes


Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -