Detailed information of oriT

oriT

The information of the oriT region


oriTDB ID   105211
Name   oriT_RHBSTW-00269|unnamed in_silico
Organism   Citrobacter freundii strain RHBSTW-00269
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP055548 (1065..1124 [+], 60 nt)
oriT length   60 nt
IRs (inverted repeats)     _
Location of nic site      _
Conserved sequence flanking the
  nic site    		  _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 60 nt

>oriT_RHBSTW-00269|unnamed
GGGTTTCGGGGCGCAGCCCTGAACCAGTCACGTAGCGCTAGCGGAGTGTATACTGGCTTA

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase

ID   3588 GenBank   WP_181499710
Name   Relaxase_HV141_RS26440_RHBSTW-00269|unnamed insolico UniProt ID   _
Length   213 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 213 a.a.        Molecular weight: 23693.91 Da        Isoelectric Point: 8.3822

>WP_181499710.1 relaxase/mobilization nuclease domain-containing protein, partial [Citrobacter freundii]
MIVKFHPRGRGGGAGPVDYLLGKDRQREGASVLQGKPEEVRELIDASPYAKKYTSGVLSFAEQDLPPGQR
EKLMASFERVLMPGLDKDQYSVLWVEHQDKGRLELNFLIPNTELLTGRRLQPYYDRADRPRIDAWQTIVN
GRLGLHDPNAPENRRALVTPSALPEMKQEAAQAITRGLLALASSGELKTRQDVTEALESAGFEVVRTTKS
SIS

  Protein domains


Predicted by InterproScan.

Relaxase/Mobilisation nuclease domain (Relaxase)

(56-211)


  Protein structure



No available structure.




Auxiliary protein

ID   1603 GenBank   WP_181479948
Name   WP_181479948_RHBSTW-00269|unnamed insolico UniProt ID   _
Length   107 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  Auxiliary protein sequence


Download         Length: 107 a.a.        Molecular weight: 11718.43 Da        Isoelectric Point: 7.8686

>WP_181479948.1 MULTISPECIES: MobC family plasmid mobilization relaxosome protein [Enterobacteriaceae]
MLTMWVTEDEHRRLLERCDGKQLAAWMRQTCLDEKPARAGKLPSLSPALLRQLAGMGNNLNQIARQVNAG
GGSGHDRVQVVAALMAIDAGLERLRNAVLEKGGDDDR

  Protein domains


Predicted by InterproScan.

Bacterial mobilisation protein (MobC) (MobC)

(50-94)


  Protein structure



No available structure.




Host bacterium

ID   5649 GenBank   NZ_CP055548
Plasmid name   RHBSTW-00269|unnamed Incompatibility group   Col440II
Plasmid size   3438 bp Coordinate of oriT [Strand]   1065..1124 [+]
Host baterium   Citrobacter freundii strain RHBSTW-00269

Cargo genes

Drug resistance gene   -
Virulence gene   -
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -