Detailed information of oriT

oriT


The information of the oriT region


oriTDB ID   105170
Name   oriT_pRHBSTW-00814_2 in_silico
Organism   Escherichia marmotae strain RHBSTW-00814
Sequence Completeness      -
NCBI accession of oriT (coordinates [strand])   NZ_CP056160 (48897..48980 [+], 84 nt)
oriT length   84 nt
IRs (inverted repeats)      28..33, 37..42  (GCCATC..GATGGC)
Location of nic site      _
Conserved sequence flanking the
  nic site  
 
 _
Note   Predicted by oriTfinder 2.0

  oriT sequence  


Download         Length: 84 nt

>oriT_pRHBSTW-00814_2
ACGGGACAGGATATGTTTTGTTGAACCGCCATCTTCGATGGCCGTTCAACAAAACCCCTGGTCAGGGCGCAGCCCCGACACCCC

Visualization of oriT structure

  oriT secondary structure

Predicted by RNAfold.

Download structure file


Relaxase


ID   3568 GenBank   WP_181475202
Name   Relaxase_HV284_RS24330_pRHBSTW-00814_2 insolico UniProt ID   _
Length   644 a.a. PDB ID   
Note   Predicted by oriTfinder 2.0

  Relaxase protein sequence


Download         Length: 644 a.a.        Molecular weight: 74898.88 Da        Isoelectric Point: 6.6215

>WP_181475202.1 TraI/MobA(P) family conjugative relaxase [Escherichia marmotae]
MDKKPGELLSPDNPYVRPVRSREAIVEHLGQFIEEGMDLYRNHVLSRSDDGRQQVLCGEVLCETNCFGIE
TAAAEMDAVASQNRRCQDPVYHAILSWREEDNPTNEQIFECARYALKALNMSDHQYVFAIHRDTEHVHCH
ITVNRINPKTYRAASLYDDYFRLHKACRELEQKYGFTPDNGCCQKDENGNWIRKQEEFKSIPRKARQMEY
HADKESLYSYAVDEARHTIGKILHSGEATWEALHTELIRLGLELKEKGEGLAVYSRHDDTVTPIKASTLH
PDLTKRVLEPYLGKFTPSPVVENYFDENDNYLGSNYPQEYVYDVRAHKRDIGASSARREERADAREALKA
RYNAYRAGWTRPEMDRDEIRARFYHVSGQFAWRRAQVRAEIRDPLLRKLAYNVLALERRQAMIALKETLR
EERKAFYARPENRRMGYWQWVEQQALNNDAAAISCLRGRFYMQKKMQQENRLSENAIVCAVADDIRPYEI
EGYQTQITRDGRIQYCQDGEVKLQDTGDRIEIVDPYSQDGQHIAGAMVLAEVKSGERMYFAGEPQFVNKA
CSIVPWFNEGSEKPLPLTDRAQRQMAGYDTAPASPQKDEPEIARESLRWLMEGAPKTPVQEDVRQQQKHD
YVHDSSYSSRYRRH

  Protein domains


Predicted by InterproScan.

(63-289)

(493-563)


  Protein structure



No available structure.




T4CP


ID   3532 GenBank   WP_249415932
Name   t4cp2_HV284_RS24520_pRHBSTW-00814_2 insolico UniProt ID   _
Length   494 a.a. PDB ID   _
Note   Predicted by oriTfinder 2.0

  T4CP protein sequence


Download         Length: 494 a.a.        Molecular weight: 55978.92 Da        Isoelectric Point: 6.5712

>WP_249415932.1 hypothetical protein [Escherichia marmotae]
MLPKVDGSSADWQDKARPMLYGLVYSLHYKCRRENLRFSLAMLHKHLPLKEMAALYIEGKQNGWHQEGIN
ALENYLSTLAGFQMDLVSRPGEWDQGVFDQHGFLIQQFSKMLAMFNDVYGHIFANDAGDIDLRDVLHNDR
ALVVLIPALELSKSESASLGKLYISAKRMVIARDLGYHLEGKREEVLTAKKYRNRFPFPDIHDELGSYFA
PGMDDLAAQMRSLGYMLIISAQDIQRFIAQFRGEYQTVNANLLVKWFMALQDEKDTYELARSTAGKDYFA
ELGEVKRSPGLFGNQFEDATTTHIREKDRISLDELKNLNPGEGFISFKSALVPCNAVYIPDDEKLSSKLQ
MRINRFIDIGRPSESELVKKNPSLARLLPPDSQEVSLVLQRTDEIMAGMAPRNPPPVVDPILARLAEITL
NLDNRCDISYTPEQRGILLFEAAREAMKHSRGRWFLAQTRHRPISVSDQVAHKLATDSTAFPSPVNTDKG
TDPQ

  Protein domains



No domain identified.


  Protein structure



No available structure.




T4SS


T4SS were predicted by using oriTfinder2.

Region 1: 85820..113587

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HV284_RS24515 (HV284_24525) 83084..83584 - 501 WP_181475210 phospholipase D family protein -
HV284_RS24520 (HV284_24530) 83614..85098 - 1485 WP_249415932 hypothetical protein -
HV284_RS25320 85273..85830 - 558 WP_249415933 hypothetical protein -
HV284_RS24525 (HV284_24535) 85820..86740 - 921 WP_181475168 hypothetical protein trbB
HV284_RS24530 (HV284_24540) 86750..88123 - 1374 WP_181475169 conjugal transfer protein TrbA trbA
HV284_RS24535 (HV284_24545) 88410..88547 - 138 WP_181475170 Hok/Gef family protein -
HV284_RS24540 (HV284_24550) 88907..89560 - 654 WP_181475171 DUF5710 domain-containing protein -
HV284_RS24545 (HV284_24555) 89599..89955 - 357 WP_107135981 hypothetical protein -
HV284_RS24550 (HV284_24560) 90209..90415 - 207 WP_038808981 hemolysin expression modulator Hha -
HV284_RS24555 (HV284_24565) 91148..91711 - 564 WP_243053450 hypothetical protein -
HV284_RS24560 (HV284_24570) 91724..93877 - 2154 WP_181475172 DotA/TraY family protein traY
HV284_RS24565 (HV284_24575) 93961..94305 - 345 WP_215251741 hypothetical protein -
HV284_RS25325 94307..94621 - 315 WP_249415934 hypothetical protein -
HV284_RS24570 (HV284_24580) 94957..95250 - 294 WP_063848353 type II toxin-antitoxin system RelE/ParE family toxin -
HV284_RS24575 (HV284_24585) 95250..95522 - 273 WP_063848352 type II toxin-antitoxin system Phd/YefM family antitoxin -
HV284_RS24580 (HV284_24590) 95659..95805 - 147 WP_181475174 hypothetical protein -
HV284_RS24585 (HV284_24595) 95950..96480 - 531 WP_163516558 conjugal transfer protein TraX -
HV284_RS24590 (HV284_24600) 96477..97697 - 1221 WP_001039317 conjugal transfer protein TraW traW
HV284_RS24595 (HV284_24605) 97721..100777 - 3057 WP_181475175 ATP-binding protein traU
HV284_RS24600 (HV284_24610) 100781..101392 - 612 WP_181475176 hypothetical protein traT
HV284_RS24605 (HV284_24615) 101410..101655 - 246 WP_181475177 hypothetical protein -
HV284_RS24610 (HV284_24620) 101711..102118 - 408 WP_001059622 DUF6750 family protein traR
HV284_RS24615 (HV284_24625) 102150..102674 - 525 WP_212768175 conjugal transfer protein TraQ traQ
HV284_RS24620 (HV284_24630) 102685..103386 - 702 WP_105289550 conjugal transfer protein TraP traP
HV284_RS24625 (HV284_24635) 103387..104508 - 1122 WP_249415935 conjugal transfer protein TraO traO
HV284_RS24630 (HV284_24640) 104583..105644 - 1062 WP_181475179 DotH/IcmK family type IV secretion protein traN
HV284_RS24635 (HV284_24645) 105641..106312 - 672 WP_097314225 DotI/IcmL/TraM family protein traM
HV284_RS24640 (HV284_24650) 106332..106811 - 480 WP_105289547 hypothetical protein traL
HV284_RS24645 (HV284_24655) 106826..110437 - 3612 WP_181475180 DUF5710 domain-containing protein -
HV284_RS24650 (HV284_24660) 110455..110715 - 261 WP_050939877 IcmT/TraK family protein traK
HV284_RS24655 (HV284_24665) 110708..111880 - 1173 WP_176559148 plasmid transfer ATPase TraJ virB11
HV284_RS24660 (HV284_24670) 111886..112668 - 783 WP_181475181 type IV secretory system conjugative DNA transfer family protein traI
HV284_RS24665 (HV284_24675) 112665..113090 - 426 WP_181475182 DotD/TraH family lipoprotein -
HV284_RS24670 (HV284_24680) 113117..113587 - 471 WP_157917732 lytic transglycosylase domain-containing protein virB1
HV284_RS24675 (HV284_24685) 113587..114084 - 498 WP_181475183 hypothetical protein -
HV284_RS24680 (HV284_24690) 114094..114336 - 243 WP_105289541 hypothetical protein -
HV284_RS24685 (HV284_24695) 114475..114675 - 201 WP_105289540 hypothetical protein -
HV284_RS24690 (HV284_24700) 114665..115342 - 678 WP_181475184 DUF2913 family protein -
HV284_RS24695 (HV284_24705) 115440..115952 - 513 WP_105289538 transcription termination/antitermination NusG family protein -


Host bacterium


ID   5608 GenBank   NZ_CP056160
Plasmid name   pRHBSTW-00814_2 Incompatibility group   IncI1
Plasmid size   116663 bp Coordinate of oriT [Strand]   48897..48980 [+]
Host baterium   Escherichia marmotae strain RHBSTW-00814

Cargo genes


Drug resistance gene   -
Virulence gene   faeC, faeD, faeE, faeF, faeH, faeI, faeJ, papD, papC, papH
Metal resistance gene   -
Degradation gene   -
Symbiosis gene   -
Anti-CRISPR   -